SecReT6
Protein ID: 218709309
SecReT6 ID323
T6SS typei5
Gene symbol-
Locus tagVS_1318
StrainVibrio splendidus LGP32
Repliconchromosome I [GenBank: NC_011753] [Browse all T6SS(s) in this replicon]
Location [Strand]1419523..1422915 [-]
Producthypothetical protein
NoteTssM
UniProt IDB7VNA5
KEGG IDvsp:VS_1318
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 7.40E-49, Aligned region: 168..422
IcmF-related [PF06761], Evalue: 6.10E-47, Aligned region: 83..103
IcmF-related [PF06761], Evalue: 6.10E-47, Aligned region: 290..384
IcmF-related [PF06761], Evalue: 6.10E-47, Aligned region: 482..768
DUF1215 [PF06744], Evalue: 2.30E-29, Aligned region: 181..209
DUF1215 [PF06744], Evalue: 2.30E-29, Aligned region: 287..311
DUF1215 [PF06744], Evalue: 2.30E-29, Aligned region: 875..991
Protein Sequence: 1130 a.a.     [Download]
>gi|218709309|ref|YP_002416930.1| hypothetical protein VS_1318 [Vibrio splendidus LGP32]
MPKTKSNKSGNTKKTVGISILVSFALFTVVSSIILLTPLNAYLTWALATTAIISTLVGLVCYWVLSNRSE
PSQKESFDKSLIQKRQKQLAYHFKRMVSKQRPKARLTSRYDLPIYLLLSQNPNKDKSIITQMGYESYKLD
DFGSDIEFPILFWVSEHSILVSVSTGEDQHPEYLKTLCQSLTAWRPRQAANGLLLTTDVASLLENNEQIT
QKADELKSTIKTFNQAFGVSLPIYNVISNMGSISDFCQFFSAFDESKRDDVFGATAPYSKHGGIDADWFN
DEYDHLISELIANMSNALAGQLNQDYRNSIASAPFQFGLLKQNLWLFLNRLYRGEQLSDALQFRGFYFTH
DGQSSAQSDLLASTVSYSVGHEHYQHNEQIPVNQTLFAQYLMTHVILSEHELVGVNKRKENALLVNQVIF
TLSWASLLTAVLLVIKFDFDFQNQREAEADVMLERYKEAISASPYDIENMAENIPNLFSLQRIYNLYNEP
EPWYTLPFMPNSSIKGEIEKAYFAALQKVLIPSMENTLEKDLFVYVNLEDQSQTLALLNNYRLLFSKNRT
NLHELKNYYMRTFQDQGEADSVNIAQLEVLLNDIFARNLTPVKSNHDLENLAKKVITQTGIGTLLYEHIQ
SSETYSKRVDIRSDLGDNWGSVLQFPTSYVGYLVPYIYTPTGFNELDLSVNSPTLKAALQSYEGVAGAYP
SALEMHRISRELKQTYQNDYINYWRDLISNVKVNEIADPAQLKKAFASLSSANSNPLVSLYSTVAKYTYV
ELEIPDNEGKSQDPATIPIQDQDKKESARQITLSFQAYKKQVSANDQGKKPIDNLLSAIINANKWADKFY
ETKEPQKVAFDTLSVTLQAGNPIASLSNLSNDHLAVAEEVISKIVHQSNEMVMSLAHDHLNTAWSNEVYQ
PYQQRLASFYPFNRQSKLDVSVADLKAFFVTNGIVDKFSQNRLNGFVKNNDEAPYLPGLLPGTALSITPD
VWTMMDKASDIKNALFLADPSNIQIDFQVKAVDMTPNITEFSIISDKPIFTYRHGPTLWSQQSWQGDSEF
IEKLGVQLNAQDSIIGQSTVKGTWSWFRLFGPNVSFSSAQDTQVEFVYGDSKVKLTIKTQGQSNPFVPGF
FSGFSLPSDI
 
Nucleotide Sequence: 3393 bp     [Download]
>gi|294514841|ref|NC_011753.2|:c1422915-1419523 Vibrio splendidus LGP32 chromosome 1, complete sequence
ATGCCGAAAACTAAATCAAACAAATCGGGCAATACAAAAAAAACAGTAGGTATCTCGATCCTAGTATCTT
TTGCCCTTTTTACCGTCGTCTCTAGCATAATTCTATTAACACCTCTCAACGCATATTTGACGTGGGCTCT
AGCTACTACCGCAATTATATCTACACTTGTAGGCTTAGTATGTTACTGGGTTCTTAGCAACCGCAGTGAA
CCATCACAAAAAGAGTCATTCGACAAATCGCTGATTCAGAAAAGACAAAAGCAACTGGCATACCATTTCA
AACGCATGGTCAGCAAGCAACGACCAAAAGCTCGCTTAACGAGTCGTTACGACCTGCCAATCTACCTACT
ATTGAGTCAAAATCCGAATAAAGACAAAAGTATCATCACTCAAATGGGTTATGAGTCATATAAGCTCGAC
GATTTTGGCAGTGATATTGAATTCCCAATTCTATTTTGGGTCAGCGAGCATTCCATTTTAGTTTCGGTAA
GCACTGGCGAAGATCAACACCCAGAATACCTAAAAACACTCTGTCAGTCCCTAACAGCATGGCGCCCGAG
GCAGGCCGCGAATGGTTTATTGCTCACGACTGACGTAGCTTCATTGTTGGAAAATAATGAACAAATAACA
CAAAAAGCTGATGAACTAAAATCGACAATAAAAACGTTTAATCAGGCTTTTGGGGTCAGCTTACCTATTT
ATAACGTTATCTCTAACATGGGTAGCATCAGCGATTTTTGTCAGTTTTTCTCAGCATTTGACGAATCAAA
AAGAGACGACGTATTCGGCGCCACGGCTCCTTATTCTAAACACGGTGGTATCGACGCAGACTGGTTTAAT
GATGAATACGACCATTTAATCAGTGAGTTGATAGCCAACATGAGCAACGCGCTTGCAGGTCAACTCAACC
AGGATTATCGAAACTCAATTGCTAGCGCCCCTTTCCAGTTTGGATTATTGAAACAAAACCTTTGGTTGTT
CCTCAACCGCTTGTACCGTGGAGAGCAGCTTAGTGACGCTCTTCAATTCCGCGGATTTTACTTTACTCAT
GATGGTCAAAGCTCAGCTCAGTCTGACTTGTTGGCGAGCACTGTATCTTATTCGGTAGGTCATGAGCATT
ATCAACACAATGAGCAGATCCCGGTTAACCAGACCCTTTTTGCTCAATACCTTATGACACACGTGATTTT
ATCCGAGCACGAACTGGTTGGGGTAAACAAGCGTAAAGAAAACGCATTGTTAGTTAACCAAGTGATTTTC
ACACTATCTTGGGCTAGCTTACTAACCGCCGTATTACTTGTGATTAAGTTTGACTTTGATTTCCAGAATC
AACGAGAAGCTGAAGCCGATGTAATGCTTGAGCGCTATAAAGAAGCGATATCAGCATCTCCTTACGACAT
CGAAAACATGGCTGAAAACATACCTAATCTGTTTTCATTACAGCGAATTTATAACCTCTATAATGAGCCT
GAGCCATGGTATACGCTGCCATTTATGCCTAACTCTAGTATCAAAGGAGAGATCGAAAAAGCATATTTTG
CAGCGTTACAGAAAGTACTGATTCCTTCTATGGAAAATACCCTAGAGAAAGACCTATTTGTGTACGTCAA
TCTCGAAGATCAATCTCAGACTCTAGCTTTGCTGAATAACTACCGTTTATTGTTCAGTAAAAATAGGACT
AACCTTCATGAGCTTAAAAACTACTACATGCGTACATTCCAAGACCAAGGTGAAGCAGATAGTGTCAATA
TTGCTCAACTAGAGGTGCTACTGAATGACATCTTCGCGCGTAACCTAACACCAGTGAAATCAAATCACGA
TTTAGAGAACCTAGCGAAGAAAGTCATTACTCAAACAGGTATCGGAACTCTATTGTATGAACACATTCAA
AGTTCAGAAACCTACTCAAAGCGCGTCGATATTCGAAGTGATTTAGGCGATAATTGGGGTTCAGTTCTAC
AATTCCCAACAAGTTATGTGGGCTACCTGGTTCCATATATCTATACACCAACGGGGTTTAATGAGCTCGA
TTTATCCGTCAACTCACCTACTCTAAAAGCAGCCTTACAATCATATGAAGGGGTTGCAGGGGCCTATCCG
AGTGCACTCGAAATGCACAGAATCAGCCGTGAACTAAAGCAAACTTATCAAAATGACTACATAAATTATT
GGCGAGATCTCATTAGCAATGTAAAAGTCAATGAAATAGCGGATCCTGCACAACTAAAAAAAGCATTCGC
TAGCCTATCAAGTGCAAACAGTAACCCACTGGTCAGCCTGTACTCAACCGTCGCTAAGTACACCTATGTG
GAGCTCGAAATACCAGACAACGAGGGTAAATCGCAAGATCCTGCGACCATACCAATTCAAGACCAAGATA
AAAAAGAATCTGCACGCCAGATAACTTTAAGCTTTCAAGCATACAAAAAACAGGTCTCTGCCAACGATCA
AGGGAAGAAGCCAATAGACAATCTGCTGAGTGCGATTATTAATGCAAATAAATGGGCAGACAAGTTTTAT
GAAACCAAAGAACCTCAAAAAGTAGCCTTCGATACTTTATCTGTGACTTTGCAAGCTGGTAACCCTATTG
CATCATTATCGAACTTATCAAACGATCATTTAGCTGTAGCAGAAGAAGTGATAAGTAAAATTGTGCATCA
AAGTAATGAAATGGTGATGTCGCTGGCTCATGACCACCTTAATACAGCATGGTCAAACGAAGTTTATCAA
CCATACCAACAACGATTAGCGTCTTTTTATCCATTCAACCGACAGTCCAAACTGGATGTGAGCGTTGCTG
ATCTCAAGGCCTTCTTCGTTACAAACGGTATAGTTGATAAGTTCTCTCAAAATCGCCTCAATGGATTCGT
TAAAAACAATGACGAAGCACCTTACTTACCAGGGCTGTTGCCTGGTACTGCGCTATCTATCACGCCAGAT
GTATGGACAATGATGGACAAAGCTTCTGATATCAAAAACGCTCTTTTCCTAGCTGATCCATCAAACATTC
AGATCGATTTCCAAGTAAAAGCTGTTGATATGACACCAAACATTACCGAATTTTCAATCATTTCGGACAA
ACCGATCTTCACTTACCGTCACGGGCCGACCTTATGGAGTCAGCAATCATGGCAAGGAGACTCCGAGTTT
ATCGAGAAACTAGGAGTCCAGTTGAACGCACAAGACTCCATAATTGGCCAAAGTACAGTCAAAGGTACAT
GGAGTTGGTTCCGCTTATTCGGTCCAAATGTGAGTTTTTCATCCGCTCAAGATACACAAGTTGAGTTTGT
GTATGGTGACAGTAAAGTAAAACTGACCATCAAAACTCAGGGTCAGTCGAACCCGTTTGTTCCCGGCTTC
TTCTCTGGATTCTCGTTACCAAGTGATATCTAG
 Primer design