SecReT6
Protein ID: 218888822
SecReT6 ID324
T6SS typei3
Gene symbol-
Locus tagPLES_00781
StrainPseudomonas aeruginosa LESB58
Repliconchromosome [GenBank: NC_011770] [Browse all T6SS(s) in this replicon]
Location [Strand]90608..93913 [-]
Producthypothetical protein
NoteTssM
UniProt IDB7V0W3
KEGG IDpag:PLES_00781
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 2.00E-98, Aligned region: 15..52
ImcF-related_N [PF14331], Evalue: 2.00E-98, Aligned region: 117..380
ImcF-related_N [PF14331], Evalue: 2.00E-98, Aligned region: 629..672
IcmF-related [PF06761], Evalue: 1.30E-91, Aligned region: 159..179
IcmF-related [PF06761], Evalue: 1.30E-91, Aligned region: 429..724
DUF1215 [PF06744], Evalue: 5.50E-41, Aligned region: 619..651
DUF1215 [PF06744], Evalue: 5.50E-41, Aligned region: 839..960
AAA_10 [PF12846], Evalue: 0.0011, Aligned region: 55..212
AAA_10 [PF12846], Evalue: 0.0011, Aligned region: 523..608
AAA_16 [PF13191], Evalue: 0.0036, Aligned region: 52..180
AAA_16 [PF13191], Evalue: 0.0036, Aligned region: 517..570
AAA_16 [PF13191], Evalue: 0.0036, Aligned region: 702..774
Protein Sequence: 1101 a.a.     [Download]
>gi|218888822|ref|YP_002437686.1| unnamed protein product [Pseudomonas aeruginosa LESB58]
MQSLAEVSAPDAASVATAEELATLKQRMDEALALLKRAKLGGSERRNLYELPWYVIIGPPGSGKTTALMN
SGLDFPLAAQMGAGAIRGVGGTRNCDWWFTDEAVLLDTAGRYTTQDSHAQVDKAAWLGFLDLLKTQRKRR
PIDGAFIAISLSDLLLGSDAERAAHAQAIRARIQELYQQLGVRFPIYVMLTKFDLVPGFMEFFDSLNREE
RAQVWGMTFALDDGKSAEGPLAVFDSEFALLEQRLTARLVERLQQERDPARRDLVYGFPQQFAALRECLG
EFLNGVFKPNPYEERPLLRGLYFTSGTQEGSPIDRLIGSMAQSMNLDRQHLARQTGTGRSYFIERLFREV
AFGERGLVGTNPKVERRRKWLTIGALSATALVVLAVTAVWIASYRANQSYIAAVDQRVDPLARGIESLSP
AQRDVLAVLPQLNAVQNLAGDAPSWAEGYGLYQGDMLGEESASVYRKLLIAVFAPRLVTRIEEQLRSGGS
SDFLYEGLKAYLMLGSPDHYDADFIKAWISLDWERNLPRDLSPEQRQALHAHLDALLERRPPSARLDQDL
VEDLRRQLQQLPVAQRVYDRVKRQRLPKDMPDFRISDAAGRDAPLVFARKSGKPLTDPLSGFFTYRGYRE
VFLTASLSQAGTIAEEQWVLGRDLNDAGDAANLALDVRRLYFQDYLRQWDDLLADLTVVPITNVTQAADV
LRILSGPTSPFRKLLEAVARETDLQKGDRLVAAQVKKAADGTVDKLKQRLGSLVGQEEEGTREQPRQVDS
DPISAHFAELNSLVSKGEGGNEPAPIDSLLEDMNALYVQVSAMAGASGDSLLGDAKNQVAAAASRVALSA
ERQPPVVQGLVKNVVNSTTSSMMGSVRNQLNAAWISDVVSVYRQSLAGRYPIAAGSSRDATLEDFGHFFG
AGGVMDTYFRQYLQPYVDTSASTWRWQPGAAQKLGINPGVLHTFQRAAAIRDAFFRSGGMQPTVRFELKP
VTMDAAISQFILDLDGQQLTYDHGPSRPVAMQWPSANGLGVVRLTVTPPPSSGRSGLTLEGPWAWFRLLD
QSDLERGNSPDRFTLRLRIDGSSIACELRASSAFNPFKSRVVSGFSLPERL
 
Nucleotide Sequence: 3306 bp     [Download]
>gi|218888746|ref|NC_011770.1|:c93913-90608 Pseudomonas aeruginosa LESB58 chromosome, complete genome
ATGCAGAGTCTCGCCGAGGTCAGCGCGCCGGACGCCGCCAGCGTCGCCACCGCCGAAGAGCTGGCGACCC
TCAAGCAACGCATGGACGAGGCCCTGGCCCTGCTCAAGCGGGCCAAGTTGGGCGGCAGCGAGCGGCGCAA
CCTGTACGAGTTGCCCTGGTACGTGATCATCGGCCCGCCCGGTTCGGGCAAGACCACCGCGCTGATGAAT
TCCGGCCTCGACTTCCCGCTCGCCGCGCAGATGGGCGCCGGGGCGATCCGCGGGGTCGGCGGCACGCGCA
ACTGCGACTGGTGGTTCACCGACGAAGCGGTGCTGCTGGACACCGCCGGCCGCTATACCACCCAGGACAG
CCACGCCCAGGTGGACAAGGCCGCCTGGCTGGGCTTCCTCGACCTGCTCAAGACCCAGCGCAAGCGCCGC
CCCATCGATGGCGCGTTCATCGCCATCAGCCTTTCCGACCTGCTGCTGGGCAGCGACGCCGAGCGCGCCG
CCCATGCCCAGGCGATCCGCGCGCGCATCCAGGAGCTGTACCAGCAGCTCGGGGTGCGCTTCCCGATCTA
CGTGATGCTGACCAAGTTCGACCTGGTGCCGGGCTTCATGGAGTTCTTCGACAGCCTGAACCGCGAGGAA
CGCGCGCAGGTCTGGGGGATGACCTTCGCCCTCGACGACGGCAAGAGCGCGGAAGGCCCGCTGGCAGTGT
TCGACAGCGAATTCGCCCTGCTCGAACAGCGTCTCACCGCGCGCCTGGTGGAACGCCTGCAGCAGGAGCG
CGACCCGGCGCGGCGCGACCTGGTCTACGGCTTCCCGCAGCAATTCGCCGCCCTGCGCGAATGCCTCGGC
GAGTTCCTCAACGGCGTGTTCAAGCCCAACCCCTACGAGGAACGCCCGCTGTTGCGCGGCCTGTACTTCA
CCAGCGGAACCCAGGAAGGCAGTCCGATCGACCGCCTGATCGGCAGCATGGCGCAGTCGATGAACCTCGA
CCGCCAGCACCTGGCGCGGCAGACCGGAACCGGGCGCAGCTACTTCATCGAGCGGCTGTTCCGCGAAGTG
GCGTTCGGCGAACGCGGCCTGGTCGGCACCAACCCGAAGGTCGAGCGCCGCCGCAAGTGGCTGACCATCG
GCGCGCTGAGCGCCACCGCGCTGGTGGTGCTGGCGGTGACGGCGGTATGGATCGCCAGCTACCGCGCCAA
CCAGAGCTACATCGCCGCGGTCGACCAGCGCGTCGACCCGCTGGCGCGCGGCATCGAGTCGCTGAGCCCG
GCCCAGCGCGACGTCCTGGCCGTACTGCCACAGCTCAACGCGGTGCAGAATCTCGCCGGCGACGCGCCGA
GCTGGGCCGAAGGCTACGGGCTGTACCAGGGCGACATGCTCGGCGAGGAGTCCGCCAGCGTCTACCGCAA
GCTGCTGATCGCGGTGTTCGCCCCGCGCCTGGTGACCCGCATCGAGGAACAGTTGCGCTCCGGCGGCAGC
AGCGATTTCCTCTACGAGGGCCTGAAGGCCTACCTGATGCTCGGCAGCCCGGACCATTACGACGCCGACT
TCATCAAGGCCTGGATCAGCCTCGACTGGGAACGCAACCTGCCGCGCGACCTCTCGCCGGAACAGCGCCA
GGCGCTGCACGCGCACCTCGACGCGTTGCTCGAACGACGGCCGCCGTCGGCGCGCCTGGACCAGGACCTG
GTCGAGGACCTGCGCCGCCAGTTGCAGCAACTGCCGGTGGCGCAGCGGGTCTACGACCGGGTCAAGCGGC
AGAGGCTGCCCAAGGACATGCCCGACTTCCGCATCAGCGACGCCGCCGGCCGCGACGCGCCGCTGGTGTT
CGCGCGCAAGAGCGGCAAGCCGCTCACCGACCCGCTCAGCGGCTTCTTCACCTACCGCGGCTATCGCGAG
GTGTTCCTCACCGCCAGCCTCAGCCAGGCCGGCACCATCGCCGAGGAACAGTGGGTGCTCGGGCGCGACC
TGAACGATGCCGGCGACGCCGCCAACCTGGCCCTCGACGTGCGTCGCCTGTATTTCCAGGACTACCTGCG
GCAGTGGGACGACCTGCTCGCCGACCTCACCGTGGTGCCGATCACCAATGTCACCCAGGCCGCCGACGTG
CTGCGCATTCTCTCCGGGCCGACCTCGCCGTTCCGCAAGCTGCTCGAGGCAGTGGCCCGCGAGACCGACC
TGCAGAAGGGCGACCGGCTGGTCGCCGCGCAAGTGAAGAAGGCCGCCGACGGCACCGTGGACAAGCTCAA
GCAGCGCCTCGGCTCGCTGGTCGGCCAGGAGGAAGAGGGCACCCGCGAACAGCCGCGGCAGGTCGACAGC
GACCCGATCAGCGCCCACTTCGCCGAACTCAACAGCCTGGTCAGCAAGGGCGAGGGTGGCAACGAGCCGG
CGCCGATCGACAGCCTGCTGGAGGACATGAACGCGCTCTACGTACAGGTCAGCGCCATGGCCGGAGCCAG
CGGCGACTCGCTGCTCGGCGACGCCAAGAACCAGGTGGCCGCCGCCGCCTCGCGCGTGGCCCTCAGTGCC
GAGCGCCAGCCGCCGGTGGTCCAGGGCCTGGTGAAGAACGTGGTCAACTCCACCACCAGCAGCATGATGG
GCAGCGTGCGCAACCAGCTCAACGCGGCCTGGATCAGCGACGTGGTCAGCGTCTACCGGCAGTCCCTGGC
CGGGCGCTACCCGATCGCCGCCGGCAGTTCGCGCGACGCCACCCTGGAGGACTTCGGCCACTTCTTCGGT
GCCGGCGGGGTGATGGACACCTACTTCCGCCAGTACCTGCAACCCTACGTCGACACCTCCGCCAGCACCT
GGCGCTGGCAGCCCGGCGCGGCGCAGAAGCTCGGCATCAACCCCGGCGTGCTGCACACTTTCCAGCGCGC
AGCGGCGATCCGCGACGCCTTCTTCCGCTCCGGCGGCATGCAACCGACGGTGCGCTTCGAGCTCAAGCCG
GTGACCATGGACGCGGCGATCAGCCAGTTCATCCTCGACCTCGACGGCCAGCAGCTGACCTACGACCACG
GCCCCAGCCGCCCGGTGGCGATGCAGTGGCCGAGCGCCAACGGCCTCGGCGTGGTCCGCCTGACGGTGAC
GCCGCCGCCCAGCAGCGGCCGTTCCGGCCTGACCCTGGAAGGCCCCTGGGCCTGGTTCCGCCTGCTCGAC
CAGTCGGACCTGGAACGCGGCAACTCGCCGGACCGCTTCACCCTGCGGCTGCGCATCGACGGCTCCAGCA
TCGCCTGCGAGCTGCGCGCCAGCAGCGCCTTCAACCCCTTCAAGAGCCGGGTCGTGTCCGGCTTCAGCCT
CCCGGAGCGCCTTTGA
 Primer design