SecReT6
Protein ID: 218891664
SecReT6 ID325
T6SS typei4a
Gene symbol-
Locus tagPLES_29421
StrainPseudomonas aeruginosa LESB58
Repliconchromosome [GenBank: NC_011770] [Browse all T6SS(s) in this replicon]
Location [Strand]3233893..3237708 [+]
Producthypothetical protein
NoteTssM
UniProt IDB7V8W1
KEGG IDpag:PLES_29421
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 6.30E-35, Aligned region: 114..354
Protein Sequence: 1271 a.a.     [Download]
>gi|218891664|ref|YP_002440531.1| unnamed protein product [Pseudomonas aeruginosa LESB58]
MSGATLFMLVLLLVLLALLLGALGWWWRTRGGTEIRSFYAAVRQMEREQGWQGRYEAPWLLMLGNETEGE
QLCATWRLLPVARPAWFGRWWSDGEGAILLVPESVFLPDEGLRRQSGAWLRLLRLFLRLRGRRALDGVVW
NIPLARLQDGEQAANLGLAARRRYVELTQRLGLSLPVYVVITGMEDLPGFQELLAALPEEARERALGWSS
PFAAEAAWQSRWCEQALEEITATLTESIVELGTLRGQVDNELYCLPPRLESLRGSLQALLEPVFQGNARG
EAPRFRGLYLSGSEAAGAAADEVLPAVDAPRRRSSFASQLWARRILAEEGLAQAVPRILQLRQRWQRGIG
LAALCLCLLWGGLMTWVWRDALRDAGELSQLLHGASERYQPLDDDTRRAAQVRQNVQAWWQLVSQAPRWR
FTSLAFPSSWFSSLDARIDNAYRRVSERLLVRPLRSLLEGEASDLRAIRSDGQPGLKEGDDPSQWKDYLA
AKDLVARATTLERHNRLFAQAIDNRRTPLDDLLQLSNDALGSSYNAGSLARLAYYNRTLFAERPADLAAL
DLGRVAATAADNFHDLMARWLNAYFLTDSLERTGNALTQELAQLGQERDATAAQLLGIGELINHLQQQVN
RINLIWGNGVGQDLVPGYQNLLKSAQQSSLLGNRVEELQNLTVQLQQQFRSEWIAPPEAAGDGLLVKQGA
TLKLADDLLGLKRAIDDLKTKDFVSVALADKTLADHSLLSIDDIGVTQALSFFNDFTGYYESTLPSLNPR
YRYSVLHAAASAATEAMWQSLGPRSRSLASRNASRFDVQVKQVQVLQAALLELQDLQAGARLLLSLNALA
VADIGQALRDIDEQAVLREPVDFSRWSGAPNFGLQMFRAQDSAELKQSLNSQFNAMAAVAERHAPALEWL
QAQQSSLATADYNAFVRFSALNAELQKFKADNPASTAAQLAKLVGNDFNQMDIGSCADILNGVLLPSSRS
DLATRLVDLRQGALGRCQSLQQQQAAQAWKDLADYFNQYLAGRFPFAYSLEAADAEPGRVRHLLQLMETR
LPQVREGLAQVRSPDLPAAEDFVRRLEQAQRWLGPLFERDKSGLLGVALDIDWRSDRSLERGADQVIAWS
LYSGDQESRFPGAQDKGLTWNVGDPLKIMLRWAKNGSQRPADDPRQASLAVADLEAGWSYQGSWALLRMM
RAHFSRQRPPNVDYTEFPLVLQLPVYAPYSPENEARMFLRLSLMSLGGKTPLSIQPLPVRAPQSPFATLL
PATVASTGGTP
 
Nucleotide Sequence: 3816 bp     [Download]
>gi|218888746|ref|NC_011770.1|:3233893-3237708 Pseudomonas aeruginosa LESB58 chromosome, complete genome
ATGAGCGGCGCGACGCTGTTCATGCTGGTTCTCCTCCTGGTGCTGCTGGCGCTGCTGCTGGGGGCGCTGG
GCTGGTGGTGGCGGACCCGGGGCGGTACGGAGATCCGCAGCTTCTACGCGGCGGTCCGGCAGATGGAGCG
CGAGCAGGGCTGGCAGGGCCGCTACGAAGCGCCGTGGCTGCTGATGCTCGGCAACGAGACCGAGGGCGAG
CAGTTGTGCGCCACCTGGCGCCTGCTGCCGGTGGCGCGTCCGGCCTGGTTCGGCCGCTGGTGGTCGGACG
GCGAGGGGGCGATCCTGCTGGTGCCCGAGTCGGTGTTCCTGCCCGACGAGGGCCTGCGCCGGCAAAGCGG
CGCCTGGCTGCGCCTGTTGCGTCTGTTCCTGCGCCTGCGCGGCAGGCGCGCGCTGGACGGGGTGGTCTGG
AACATTCCGCTGGCGCGGTTGCAGGATGGCGAGCAGGCGGCCAACCTCGGCCTCGCCGCGCGCCGTCGCT
ACGTGGAACTGACCCAGCGCCTTGGCCTGAGCCTGCCGGTTTACGTGGTGATCACTGGCATGGAAGACCT
GCCTGGCTTCCAGGAACTTCTCGCGGCGCTGCCCGAGGAGGCGCGCGAGCGCGCCCTCGGCTGGTCCTCG
CCGTTCGCCGCCGAAGCGGCCTGGCAGTCGCGCTGGTGCGAGCAGGCGCTGGAGGAAATCACCGCCACCC
TGACCGAGTCGATCGTCGAACTCGGTACCTTGCGCGGCCAGGTGGACAATGAGCTGTATTGCCTGCCGCC
ACGCCTGGAAAGCCTCCGCGGTTCGTTGCAGGCGCTGCTCGAACCGGTCTTCCAGGGCAACGCCAGGGGC
GAGGCGCCGCGCTTTCGCGGTCTCTACCTGAGCGGCAGCGAGGCGGCGGGCGCGGCAGCCGACGAAGTCC
TGCCGGCGGTCGACGCGCCGCGTCGGCGCAGCAGCTTCGCCAGCCAACTGTGGGCACGGCGGATCCTTGC
CGAGGAAGGCCTGGCCCAGGCGGTGCCGCGCATCCTCCAACTGCGCCAGCGCTGGCAGCGCGGGATCGGC
CTCGCCGCGTTGTGCCTGTGCCTGCTCTGGGGCGGCCTGATGACCTGGGTCTGGCGCGACGCGCTGCGCG
ACGCCGGTGAACTGTCGCAACTGCTGCATGGCGCCAGTGAGCGCTACCAGCCGCTCGACGACGACACTCG
GCGCGCCGCCCAGGTCCGGCAGAACGTCCAGGCCTGGTGGCAACTGGTGTCACAGGCGCCGCGCTGGCGC
TTCACTTCGCTGGCGTTTCCCAGTTCCTGGTTTTCCTCCCTGGATGCACGTATCGACAACGCGTATCGCC
GCGTTTCCGAGCGCCTGCTGGTGCGACCGCTGCGCAGCCTGCTGGAAGGCGAGGCGAGCGACCTGCGGGC
GATCCGCAGCGATGGCCAACCCGGCCTGAAGGAGGGCGACGACCCCAGCCAGTGGAAGGACTACCTGGCG
GCGAAGGACCTGGTCGCCCGCGCCACTACCCTGGAGCGCCACAATCGCTTGTTCGCCCAGGCCATCGACA
ACCGCAGGACGCCGCTCGACGACCTTCTGCAACTGAGTAACGATGCCTTGGGCAGCAGCTACAACGCCGG
CAGCCTGGCGCGCCTGGCCTATTACAACCGCACGCTGTTCGCCGAGCGTCCGGCCGATCTCGCCGCCCTC
GACCTGGGCCGGGTCGCCGCCACGGCGGCGGATAACTTCCATGACCTGATGGCACGCTGGCTGAACGCCT
ACTTCCTCACCGACAGCCTGGAACGCACCGGCAATGCCCTGACCCAGGAACTCGCGCAGCTCGGCCAGGA
ACGAGACGCCACGGCGGCCCAGTTGCTGGGGATCGGCGAATTGATCAACCACCTGCAGCAACAGGTCAAC
CGCATCAACCTGATCTGGGGCAATGGCGTCGGCCAGGATCTCGTCCCTGGCTACCAGAACCTGCTCAAGA
GCGCCCAGCAAAGCAGCTTGCTGGGAAACCGCGTGGAGGAACTGCAGAACCTCACCGTGCAGTTGCAGCA
GCAGTTTCGCAGCGAATGGATCGCGCCTCCGGAGGCTGCCGGCGACGGCCTGCTGGTGAAACAGGGGGCG
ACGCTCAAGCTGGCCGATGACCTGCTCGGTCTGAAACGCGCCATCGATGACCTGAAGACCAAGGACTTCG
TCTCCGTGGCCCTGGCGGACAAGACACTGGCGGACCACTCCTTGCTGAGCATCGACGATATCGGCGTGAC
TCAGGCGTTGAGCTTCTTCAACGACTTCACCGGCTACTACGAGAGCACCCTGCCATCGCTCAACCCGCGC
TATCGCTATTCGGTCCTGCACGCCGCCGCCAGCGCGGCGACCGAAGCCATGTGGCAAAGCCTCGGGCCGC
GCAGTCGTAGCCTGGCCAGTCGCAATGCCTCGCGTTTCGACGTGCAGGTCAAGCAGGTCCAGGTGTTGCA
GGCGGCGCTGCTGGAGTTGCAGGACCTGCAGGCCGGCGCGCGCCTGCTGCTCAGCCTCAACGCGCTGGCC
GTGGCCGATATCGGCCAGGCCCTGCGCGACATCGACGAGCAGGCGGTGCTGCGCGAGCCGGTCGATTTCA
GCCGCTGGTCGGGCGCGCCGAATTTCGGCCTGCAGATGTTCCGCGCCCAGGACAGTGCCGAGCTGAAGCA
AAGCCTGAACAGCCAGTTCAATGCCATGGCGGCCGTCGCCGAACGCCACGCCCCGGCGCTGGAGTGGTTG
CAGGCGCAGCAATCCAGCCTGGCCACCGCCGACTACAACGCGTTCGTGCGCTTCAGCGCGCTCAACGCCG
AACTGCAGAAATTCAAGGCCGACAACCCGGCGAGCACCGCGGCGCAGTTGGCGAAGCTGGTGGGTAACGA
TTTCAACCAGATGGACATCGGCAGTTGCGCCGACATTCTCAACGGCGTGCTCCTGCCGTCCAGCCGCAGC
GACCTGGCGACGCGCCTGGTGGACCTGCGCCAGGGCGCGCTCGGGCGCTGCCAGTCGTTGCAACAGCAGC
AGGCGGCGCAGGCCTGGAAGGACCTCGCCGACTACTTCAACCAGTACCTCGCCGGACGCTTCCCGTTCGC
CTACAGCCTGGAAGCGGCCGATGCCGAGCCGGGGCGGGTGCGGCACCTGCTGCAACTGATGGAGACGCGC
TTGCCGCAGGTGCGCGAAGGGCTGGCCCAGGTTCGCTCGCCGGACCTGCCGGCCGCCGAGGACTTCGTCC
GCCGCCTGGAGCAGGCGCAGCGCTGGCTCGGCCCGCTGTTCGAGCGCGACAAGTCGGGCCTGCTCGGCGT
CGCCCTGGACATCGACTGGCGCAGCGACCGCAGCCTGGAACGCGGCGCCGACCAGGTGATCGCCTGGAGC
CTGTACTCGGGCGACCAGGAAAGCCGTTTCCCCGGCGCGCAGGACAAGGGCCTGACCTGGAATGTCGGCG
ATCCGCTGAAAATCATGCTGCGCTGGGCGAAGAACGGCTCGCAGCGTCCGGCAGACGACCCGCGCCAGGC
CAGCCTGGCGGTGGCCGACCTCGAGGCCGGCTGGAGCTACCAGGGCTCCTGGGCGCTGTTGCGCATGATG
CGCGCGCACTTCTCCCGGCAGCGCCCGCCGAACGTCGACTACACGGAGTTTCCGCTGGTCCTGCAACTGC
CGGTGTATGCGCCTTACAGCCCGGAAAACGAGGCGCGGATGTTCCTCCGCCTGTCGTTGATGAGCCTGGG
CGGCAAGACCCCGCTGTCCATCCAGCCGCTGCCGGTGCGCGCGCCGCAATCGCCGTTCGCGACGCTGTTG
CCGGCCACCGTCGCCAGCACCGGAGGTACCCCATGA
 Primer design