SecReT6
Protein ID: 218892374
SecReT6 ID326
T6SS typei1
Gene symbolstk1
Locus tagPLES_36561
StrainPseudomonas aeruginosa LESB58
Repliconchromosome [GenBank: NC_011770] [Browse all T6SS(s) in this replicon]
Location [Strand]4043872..4044861 [-]
Productserine-threonine kinase Stk1
NoteStk1
UniProt IDB7UV50
KEGG IDpag:PLES_36561
PDB IDNA
Domain hit(s) vs Pfam Pkinase [PF00069], Evalue: 3.70E-40, Aligned region: 51..286
Pkinase_Tyr [PF07714], Evalue: 5.10E-25, Aligned region: 53..306
APH [PF01636], Evalue: 7.70E-05, Aligned region: 97..176
APH [PF01636], Evalue: 7.70E-05, Aligned region: 171..203
APH [PF01636], Evalue: 7.70E-05, Aligned region: 229..305
RIO1 [PF01163], Evalue: 0.0016, Aligned region: 128..202
Protein Sequence: 329 a.a.     [Download]
>gi|218892374|ref|YP_002441241.1| stk1 gene product [Pseudomonas aeruginosa LESB58]
MNEPLSSLELLPEEEGGANLTYFAFAAPTASAPDLPAVLPGPLPDVLSGRYRLERMLGAGGMGTVYRARD
LLHEQFGDPAPLVALKLLNESVAESPDASALLYSEFALTRRLRHPNVVRLFTFDVDTACQRAYIVMELMP
GLPLDRLLCERPEGLPWSELSAIARPLLDVLAYVHEQGVLHGDLKPSNVMLGEDGVRLFDFGLGQAQAGI
LDGLPQLSRGRIDAWTPGYAAPELLEGAPLSPAADLYALACVLYELADGRHPFRRLPSNQAREQGLERQL
RAPGHLPRRCWPALRTALSLDPERRCIGVRELQEALGARRSWLAGVLAR
 
Nucleotide Sequence: 990 bp     [Download]
>gi|218888746|ref|NC_011770.1|:c4044861-4043872 Pseudomonas aeruginosa LESB58 chromosome, complete genome
ATGAACGAACCGCTGTCGTCGCTGGAGCTGCTGCCGGAGGAGGAGGGCGGCGCGAACCTGACCTATTTCG
CCTTCGCCGCCCCGACCGCCTCGGCGCCGGACCTGCCGGCGGTGTTGCCCGGTCCGCTGCCGGACGTTCT
TTCCGGGCGCTACCGTCTGGAGCGGATGCTCGGCGCCGGCGGCATGGGGACGGTCTACCGTGCCCGGGAC
CTGCTCCATGAGCAGTTCGGCGACCCGGCGCCGCTGGTAGCGCTGAAGCTGCTCAACGAGTCGGTCGCCG
AGTCACCCGACGCCAGCGCCTTGCTCTATAGCGAGTTCGCCCTGACCCGGCGCTTGCGCCATCCGAACGT
CGTGCGTCTGTTCACCTTCGACGTCGACACCGCATGCCAGCGCGCCTACATCGTCATGGAACTCATGCCT
GGCCTGCCGCTCGACCGCCTGCTCTGCGAGCGTCCCGAAGGCCTGCCCTGGTCCGAGCTGAGCGCGATCG
CCCGGCCGTTGCTGGATGTTCTGGCCTACGTCCACGAACAAGGAGTACTGCATGGCGACCTGAAGCCGAG
CAACGTGATGCTCGGCGAAGATGGCGTGCGGCTCTTCGACTTCGGCCTCGGCCAGGCGCAGGCAGGCATC
CTGGATGGCCTGCCGCAGCTCAGCCGGGGCCGCATCGACGCCTGGACTCCGGGCTACGCCGCTCCCGAAC
TGCTCGAGGGCGCGCCATTGTCGCCGGCGGCCGACCTGTATGCGCTGGCCTGCGTCCTCTACGAACTGGC
CGACGGTCGCCATCCGTTCCGCCGCCTGCCCTCGAACCAGGCCCGGGAGCAGGGGCTGGAGCGCCAGCTG
CGCGCGCCCGGACACCTGCCTCGGCGCTGCTGGCCGGCGCTGCGTACCGCCCTGAGCCTCGACCCCGAAC
GGCGCTGCATCGGCGTCCGCGAATTACAGGAAGCGCTGGGCGCGCGGCGTTCCTGGCTGGCCGGCGTTCT
TGCCCGTTGA
 Primer design