SecReT6
Protein ID: 218892375
SecReT6 ID326
T6SS typei1
Gene symbolstp1
Locus tagPLES_36571
StrainPseudomonas aeruginosa LESB58
Repliconchromosome [GenBank: NC_011770] [Browse all T6SS(s) in this replicon]
Location [Strand]4044858..4045586 [-]
Productserine/threonine phosphoprotein phosphatase Stp1
NoteStp1
UniProt IDB7UV51
KEGG IDpag:PLES_36571
PDB IDNA
Domain hit(s) vs Pfam PP2C_2 [PF13672], Evalue: 1.10E-16, Aligned region: 19..204
PP2C [PF00481], Evalue: 3.50E-16, Aligned region: 31..234
SpoIIE [PF07228], Evalue: 5.70E-11, Aligned region: 35..241
Protein Sequence: 242 a.a.     [Download]
>gi|218892375|ref|YP_002441242.1| stp1 gene product [Pseudomonas aeruginosa LESB58]
MQRTEPWRSAARTDRGKVRARNEDAFLDCPDRGLWAVADGMGGHQAGDLASRMIVTSLAELPARAGFDER
LNAMRQCLHWLNRRLGEELTLSAERGDRIIGSTVVALVVEGSRAACVWVGDSRCYLWRGQRLYQLSRDHS
LLQRLVDERRMDIEQARAYPSARALTRAVGASEQLVLDVLELEVHPGDVFLLCSDGLYEELSADALGRAL
SLASPQVAVERLFDGALSGAARDNLTAVVIRQ
 
Nucleotide Sequence: 729 bp     [Download]
>gi|218888746|ref|NC_011770.1|:c4045586-4044858 Pseudomonas aeruginosa LESB58 chromosome, complete genome
ATGCAACGCACCGAGCCCTGGCGCAGCGCGGCGCGCACGGATCGCGGCAAGGTCCGCGCGCGCAACGAGG
ATGCCTTCCTGGACTGCCCGGATCGCGGGCTCTGGGCGGTCGCCGATGGCATGGGCGGGCACCAGGCCGG
CGACCTGGCCAGCCGGATGATCGTCACCAGCCTGGCGGAACTGCCGGCCCGGGCGGGATTCGACGAGCGC
CTGAACGCGATGCGCCAGTGCCTGCACTGGCTCAACCGGCGCCTGGGCGAGGAACTCACCCTCAGCGCCG
AACGCGGCGACAGGATCATCGGCAGTACGGTGGTGGCGCTGGTCGTGGAGGGTTCGCGGGCGGCCTGCGT
GTGGGTCGGCGACAGCCGCTGCTACCTGTGGCGCGGCCAGCGGCTGTACCAGCTGTCCCGCGACCACTCG
CTGTTGCAGCGACTGGTCGACGAACGGCGGATGGATATCGAGCAGGCCCGCGCCTATCCCTCGGCGCGCG
CGCTGACCCGTGCCGTCGGCGCCAGCGAACAACTGGTGCTGGACGTGTTGGAACTGGAGGTGCATCCCGG
GGATGTCTTCCTGCTCTGCAGCGACGGGCTCTACGAAGAGCTGAGCGCCGATGCGCTGGGTCGCGCGTTG
AGCCTGGCATCGCCGCAGGTGGCGGTGGAGCGGCTGTTCGACGGTGCCCTGAGCGGCGCCGCACGGGACA
ACCTGACGGCCGTGGTGATCCGCCAATGA
 Primer design