SecReT6
Protein ID: 218892376
SecReT6 ID326
T6SS typei1
Gene symbol-
Locus tagPLES_36581
StrainPseudomonas aeruginosa LESB58
Repliconchromosome [GenBank: NC_011770] [Browse all T6SS(s) in this replicon]
Location [Strand]4045586..4049113 [-]
Producthypothetical protein
NoteTssM
UniProt IDB7UV52
KEGG IDpag:PLES_36581
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 1.80E-76, Aligned region: 255..273
IcmF-related [PF06761], Evalue: 1.80E-76, Aligned region: 502..792
IcmF-related [PF06761], Evalue: 1.80E-76, Aligned region: 948..996
ImcF-related_N [PF14331], Evalue: 6.90E-75, Aligned region: 196..453
DUF1215 [PF06744], Evalue: 4.10E-34, Aligned region: 910..1034
Protein Sequence: 1175 a.a.     [Download]
>gi|218892376|ref|YP_002441243.1| unnamed protein product [Pseudomonas aeruginosa LESB58]
MKNFFKKVGAFLRKTWVWTLLLALLAALLVWFVGPLLAVADYKFWESPTSRLLSISLMFLLWGLAMVFVS
WRAGVRRKAVEDSDEGQERLRRDGLIEDEQKELRSRFKDALRTLKTSSLYRGRSERWRNELPWYLLIGPQ
GSGKTSLLDFSGLEFPINRIDRKLTRDTAGTRYCDWYFADHGVLIDTAGRYLTQADGEVDGGAWATLLGL
LRKRRRARPLNGVMVSIPVETLLSDDEMALDTLARQVRARLQEIQQTLHLDLPVYLVLSKADQLLGFDEF
FDQLSREESDQVLGTSFGKEQNGTDVTVLRQAFEDLLRRLNSQVIMRIHQERDTLRRGRILDFPHQLGQI
GERLCLFVELAFTGNRYQRASRLRGFYLTSAPHLAQQLDEDTAGIGANLGIASGLLPTLRNGRSRFIHHL
LSQVIFPEANLAGLDRRERTRIHWGQRALYVGSLALLLLFGLLWAGGFSANHERLERLRELAQQWTQQRQ
ALGERDDAMAALKTLDSSYAATTVFPPKGEVSLHERAGLYQGNEVNPPLAAAYRRELETQLLPRVARMLE
AQIRGNMQNRERLLNSLRAYLMLNLRERRENGWLKDWVATDWSQRYAGNGTVQNGLNTHFARLLEQPFSY
PLNETLVAQARQVLRSESLANVVYRVLREQARSLPEYRFGQHLGPQAGLFVGTDYVIPGFYTQQGYQQYF
VVQGASLVNDILRDNWVLGEGSGISDMDLRRLMVELEQLYFRDYANFWSEAVGRLGLLPFNDAGEGADQV
SGLLAANSPILQLLLEVRENTRFPVLAESAEALAEASDKAAEKGGKLGKAAAAAAGKARDALAKNLPDTA
KKSLQRRFEPLHRLLDDNNGPAADLTPLLQALNELQLQLAGLARASQPEQAAFDMAKSRMGGQRDALSNL
RNASARLPRPLGGWFSVLAEDAWRLVLGDAYLYLNQRYQSELYGFYSKAINKRYPFNAHSASDVAVSDFR
EFFKAQGVAERFFETYMRPFVSGDPGSYRLRSVDGYSLPMSKVYLDQMGTAQVIRQSFFAENPAEPQVRF
RLEPYTLDPGVSRAEFRFDGQSMEYRHGPIVPMSFKWPSDADGGRTSLVLEKMAGRPVGIERNTGPWSLF
RLFDLMQTEYLSGRDVMVLKADLGGLRANYLLLAQRTPNPFDLAVLRSFRMPVQL
 
Nucleotide Sequence: 3528 bp     [Download]
>gi|218888746|ref|NC_011770.1|:c4049113-4045586 Pseudomonas aeruginosa LESB58 chromosome, complete genome
ATGAAAAACTTCTTCAAGAAAGTCGGCGCCTTCCTGCGCAAGACGTGGGTCTGGACGCTGTTGCTGGCAC
TCCTGGCGGCATTGCTGGTGTGGTTCGTCGGGCCGCTGCTGGCGGTCGCCGACTACAAGTTCTGGGAAAG
CCCGACCTCGCGGTTGCTGAGCATCAGCCTGATGTTCCTGCTCTGGGGGCTGGCGATGGTCTTCGTCAGC
TGGCGCGCCGGAGTGCGGCGCAAGGCCGTCGAGGACAGCGACGAGGGCCAGGAGCGCTTGCGCCGCGACG
GTCTGATCGAAGACGAACAGAAGGAACTGCGCAGCCGCTTCAAGGACGCCTTGCGCACCCTGAAGACCTC
CAGCCTGTACCGCGGTCGTAGCGAGCGCTGGCGCAACGAGCTGCCCTGGTACCTGCTGATCGGCCCGCAG
GGAAGCGGCAAGACCAGCCTGCTGGACTTTTCCGGACTGGAGTTCCCGATCAACCGGATCGACCGCAAGC
TGACCCGCGATACCGCCGGCACGCGCTACTGCGACTGGTACTTCGCCGACCACGGCGTCCTGATCGACAC
CGCCGGGCGCTACCTGACCCAAGCCGACGGCGAGGTCGACGGGGGCGCCTGGGCGACCCTGCTCGGCCTG
TTGCGCAAGCGCCGCCGCGCACGGCCGCTGAACGGCGTGATGGTGTCGATTCCGGTGGAAACGTTGCTCA
GCGACGACGAGATGGCGCTGGATACGCTGGCTCGCCAGGTGCGCGCGCGCCTGCAGGAAATCCAGCAGAC
CCTGCACCTCGATCTGCCGGTCTACCTGGTGCTGAGCAAGGCCGACCAGTTGCTCGGCTTCGACGAGTTC
TTCGACCAGTTGAGCCGCGAGGAGAGCGACCAGGTTCTGGGCACCAGCTTCGGCAAGGAGCAGAACGGCA
CCGATGTGACGGTTCTGCGCCAGGCGTTCGAGGACCTTCTGCGACGTCTGAACAGCCAGGTGATCATGCG
CATCCACCAGGAGCGCGATACCCTGCGTCGCGGTCGCATCCTCGACTTCCCGCACCAGCTTGGCCAGATC
GGCGAGCGGTTGTGCCTGTTCGTCGAACTCGCCTTCACTGGCAATCGCTACCAGCGCGCCAGCCGCCTGC
GCGGCTTCTACCTGACCAGCGCGCCGCACCTGGCCCAGCAGCTGGATGAAGACACCGCCGGCATCGGCGC
CAACCTGGGGATCGCCAGCGGCCTGTTGCCGACCCTGCGCAACGGGCGCTCGCGCTTCATCCATCACCTG
CTGAGCCAGGTGATCTTCCCCGAGGCCAACCTGGCAGGTCTCGATCGCCGCGAACGCACGCGCATCCACT
GGGGCCAGCGCGCCCTGTACGTCGGTTCGCTGGCGCTCCTTCTGCTATTCGGCCTGCTCTGGGCTGGCGG
TTTCTCGGCCAACCACGAGCGCCTGGAGCGGCTACGCGAGCTGGCGCAGCAATGGACCCAGCAGCGCCAG
GCGCTTGGCGAGCGCGACGACGCCATGGCGGCGCTGAAGACGCTGGATAGCAGCTATGCGGCGACCACCG
TGTTTCCGCCCAAAGGGGAAGTCTCGCTGCACGAGCGCGCCGGGCTGTACCAGGGCAACGAGGTCAACCC
GCCGCTGGCCGCTGCCTATCGCCGCGAGCTGGAGACGCAACTGCTGCCGCGCGTGGCGCGGATGCTCGAA
GCGCAGATCCGCGGCAACATGCAGAATCGCGAACGCCTGCTCAACAGCCTGCGGGCCTACCTGATGCTGA
ATCTGCGCGAGCGCCGCGAGAACGGATGGCTCAAGGACTGGGTGGCTACCGACTGGTCGCAGCGCTATGC
CGGCAACGGCACCGTGCAGAATGGCCTGAACACGCATTTCGCCCGTCTGCTCGAGCAACCGTTCAGCTAT
CCGCTGAACGAGACCCTGGTGGCCCAGGCACGCCAGGTGCTGCGCAGCGAGTCCCTGGCCAACGTGGTCT
ACCGGGTGCTGCGCGAACAGGCGCGAAGCCTGCCCGAGTATCGCTTCGGCCAGCACCTGGGGCCGCAGGC
CGGTCTGTTCGTCGGCACCGACTACGTGATCCCGGGGTTCTACACCCAGCAGGGCTACCAGCAATACTTC
GTGGTCCAGGGCGCCAGCCTGGTCAACGACATCCTTCGCGACAACTGGGTCCTGGGCGAGGGCAGCGGGA
TCAGTGACATGGACCTGCGGCGCCTGATGGTCGAACTCGAGCAGCTGTATTTCCGCGACTACGCGAACTT
CTGGAGCGAGGCGGTCGGACGCCTGGGCCTGCTGCCGTTCAACGATGCCGGCGAGGGCGCCGACCAGGTT
TCCGGGCTGCTCGCCGCCAACTCGCCGATCCTCCAGTTGTTGCTGGAGGTCCGTGAGAACACCCGTTTCC
CGGTCCTGGCGGAGAGCGCCGAGGCGCTGGCAGAGGCCAGCGACAAGGCCGCGGAAAAGGGCGGCAAGCT
GGGCAAGGCGGCCGCCGCGGCGGCCGGCAAGGCCAGGGACGCGTTGGCGAAGAACCTGCCGGATACCGCG
AAGAAGTCCCTGCAACGCCGCTTCGAGCCCCTGCATCGCCTGCTCGACGATAACAACGGCCCGGCGGCCG
ACCTCACCCCGCTGTTGCAGGCGCTCAACGAGTTGCAGTTGCAACTCGCCGGACTGGCGCGCGCCAGCCA
GCCGGAGCAGGCGGCTTTCGACATGGCGAAGAGCCGCATGGGCGGCCAGCGCGATGCCCTGAGCAACCTG
CGCAACGCCTCCGCGCGACTGCCGCGACCGCTCGGCGGATGGTTCAGCGTGCTGGCCGAAGACGCCTGGC
GGCTGGTCCTCGGCGATGCCTACCTGTACCTCAACCAGCGCTACCAGAGCGAGCTGTACGGTTTCTACAG
CAAGGCGATCAACAAGCGCTACCCGTTCAACGCGCACAGCGCCAGCGATGTCGCGGTCAGCGATTTCCGC
GAGTTCTTCAAGGCGCAGGGCGTCGCCGAACGCTTCTTCGAAACCTACATGCGGCCCTTCGTCAGCGGCG
ACCCGGGCAGTTACCGCCTGCGCAGCGTGGACGGTTACAGCCTGCCGATGTCCAAGGTCTATCTCGACCA
GATGGGCACGGCCCAGGTGATCCGCCAGAGCTTCTTCGCCGAGAACCCGGCCGAGCCACAGGTGCGCTTC
CGCCTGGAGCCCTATACCCTCGATCCTGGCGTCAGCCGCGCCGAGTTCCGTTTCGACGGTCAGTCCATGG
AGTACCGCCACGGCCCGATCGTGCCGATGTCGTTCAAGTGGCCCAGCGACGCCGACGGCGGCCGCACCAG
CCTGGTGCTGGAGAAGATGGCCGGACGACCGGTGGGAATCGAACGCAATACCGGGCCCTGGTCGCTGTTC
AGGCTGTTCGACCTGATGCAGACCGAGTACCTCAGCGGGCGTGACGTGATGGTGCTCAAGGCCGACCTGG
GCGGCCTGCGCGCCAACTACCTGCTGCTCGCCCAGCGCACGCCGAATCCGTTCGATCTCGCGGTCCTGCG
CAGCTTCCGCATGCCGGTGCAGCTCTGA
 Primer design