SecReT6
Protein ID: 218927714
SecReT6 ID17
T6SS typei3
Gene symbol-
Locus tagYPO0515
StrainYersinia pestis CO92
Repliconchromosome [GenBank: NC_003143] [Browse all T6SS(s) in this replicon]
Location [Strand]552863..556315 [+]
Producthypothetical protein
NoteTssM
UniProt IDQ0WJE9
KEGG IDype:YPO0515
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 7.80E-75, Aligned region: 484..782
DUF1215 [PF06744], Evalue: 5.10E-30, Aligned region: 891..1010
ImcF-related_N [PF14331], Evalue: 3.50E-29, Aligned region: 81..100
ImcF-related_N [PF14331], Evalue: 3.50E-29, Aligned region: 180..361
Protein Sequence: 1150 a.a.     [Download]
>gi|218927714|ref|YP_002345589.1| hypothetical protein YPO0515 [Yersinia pestis CO92]
MLYCVVDRAADRHWPLFPSGGVWVRKIIIALILFWALWPFVAIFFSWIFRYARAPLPKRKKKTVQLDRVS
ARFHDAMLTLQHADLSSQKTRWQRWRQRRKRQYIDAKPWFLVMGPPGCGKTSIVYESSEKFLLSEQYGLA
QTTDIGPTQDCNWWLTDRAVYIDTAGEWILLHGQSEEAGTARQKLFSMIRKYRRYPGVDGIVLCLDVSVL
LNSSVTERKSLADTLRLRILEVASTFQADIAVYLFLNNIDKLPGGETFLSLMNDELLAGGLGISMTHNEK
GQNNFVADEERYRELLTRVSRYVLEILHDSPNMEMRHQLLLFTESLGALQKPLFGLFEQIFPATPIGYTG
CLRQFWFGSTQNLTSWEALYYPSSTSTFESRPAGQMYFPALSQAITERGVLHATGPMPLRNRLLNIGKYV
FVVLVLCILLLMLSARYFWEYDYIGYATARFEETRRIVRDIPITNQVNDNLVAAYEQLGYINTHYLESSP
PLLTPYFEHRLLNQAMLQTYHRHLNKVFWPAVQNYVTNELKKDTQSPDGDNYDTLKVYLMLGQPDHRSQE
ALVQWFMSRWESFAPQGYGQNDRKLFSYHLSELFSDTASAAPKVKLNDELIRESRIKAMKTPIHIRVINR
IHDAPLPARIEDLSLADAAGPSVTLMLRRKSPSTVTDLAIPAFYTRASYHDVVNPQLQEASEAMINEEAW
VLSDGKASVSQVSLLAAAQKLSDEARKYYLMEYANQWDAFFNDIRVRPINGLDDAALLARQLSDPSSPLA
NLVRFSTREITLTTDNNGKGAMSSGWFNIQRNKLTTARRNIIDEMSGERSRFRLTPEKAVEDRFELLRRL
GYALQSASTSNSDPLGRTFEQIYNQLITLSTSLRAGQILPQNNDFSRLQIDMARQPEPVRSIMMDLLAVG
QTQSLQQSKANLSKGVSSIASDLCSNAVSGRYPFNRLASEEIGIGDFNRMFGRSGAMQSFFDQNLAPYVD
TNGNRWKVKPDSNGVVTPKTLRSFENSAQIRDTFFDASGKMAMSMIIRPISLTPSILEAVLDVDGQIINY
SHGSNQPVKVDWPGPKGGVYIRLTFKTQDGNVETVSFNGPWAIFRMYDVSNPRPLGVNSRELMMVMDNVS
GVFKIELSSTMKDYPLWSKALAQFSCPKNL
 
Nucleotide Sequence: 3453 bp     [Download]
>gi|16120353|ref|NC_003143.1|:552863-556315 Yersinia pestis CO92 chromosome, complete genome
TTGTTATATTGTGTGGTGGATAGGGCCGCTGATCGCCATTGGCCCCTATTTCCCTCTGGGGGGGTATGGG
TTCGTAAGATCATTATTGCTCTGATTTTATTTTGGGCACTGTGGCCATTTGTTGCAATTTTCTTCAGTTG
GATTTTTCGTTATGCCCGTGCGCCACTTCCCAAGCGCAAGAAAAAAACGGTTCAGCTTGATCGCGTTTCT
GCACGTTTTCATGATGCGATGCTCACCCTGCAACATGCGGATCTTTCAAGCCAGAAAACACGCTGGCAGC
GCTGGCGTCAACGGCGTAAGCGCCAGTATATCGATGCTAAACCGTGGTTTCTGGTCATGGGGCCACCCGG
ATGCGGTAAAACGTCGATAGTTTATGAGAGTAGCGAGAAGTTCCTACTCTCAGAACAGTATGGTTTAGCG
CAGACCACGGATATTGGACCGACGCAGGACTGTAATTGGTGGCTGACGGATCGTGCTGTTTACATCGATA
CGGCAGGGGAATGGATCCTGCTGCATGGTCAGAGCGAAGAAGCGGGCACGGCTCGGCAAAAATTGTTCTC
TATGATCCGCAAATATCGCCGTTATCCGGGGGTTGATGGGATTGTTCTTTGCCTTGACGTCAGCGTGCTT
TTGAACTCTTCGGTGACGGAACGTAAGTCACTGGCTGATACGTTGCGCCTGCGGATCCTGGAAGTTGCCT
CGACATTTCAGGCCGATATTGCGGTGTACTTGTTCCTCAACAATATCGATAAGTTACCTGGCGGCGAAAC
CTTCCTCTCGTTAATGAACGACGAACTTCTGGCCGGAGGGCTTGGGATTAGCATGACCCATAATGAAAAG
GGGCAGAACAATTTCGTTGCCGATGAAGAACGTTACCGTGAACTCCTGACACGTGTTAGCCGTTATGTGT
TGGAAATACTGCACGATTCGCCCAACATGGAGATGCGCCACCAATTGCTGCTGTTTACAGAAAGCCTGGG
AGCGCTACAAAAACCCCTGTTTGGCTTATTCGAACAAATATTTCCGGCGACACCGATTGGCTATACCGGT
TGTTTGCGGCAGTTCTGGTTTGGCAGTACCCAAAATCTGACCTCATGGGAGGCGCTGTATTATCCGTCAT
CGACCAGCACCTTTGAAAGCCGGCCTGCTGGGCAGATGTATTTCCCTGCACTGAGTCAAGCGATCACCGA
AAGGGGGGTATTACACGCCACTGGCCCCATGCCTTTGCGAAATCGCCTGTTAAACATCGGTAAATATGTG
TTCGTGGTCCTTGTGCTCTGCATCTTATTGTTGATGCTGAGCGCCCGCTATTTTTGGGAATATGACTATA
TTGGCTATGCGACAGCTCGGTTTGAGGAAACCCGTCGGATTGTGCGTGACATCCCAATCACGAATCAGGT
CAACGATAATCTGGTCGCAGCTTACGAACAGTTGGGGTATATCAACACCCATTATCTGGAAAGTTCACCG
CCACTGCTGACACCGTACTTCGAGCACCGTTTACTGAATCAGGCGATGTTGCAAACCTACCATCGTCACC
TGAATAAAGTGTTCTGGCCTGCGGTACAAAACTACGTCACCAACGAGCTGAAAAAGGACACTCAATCTCC
TGACGGTGACAACTATGACACGCTGAAAGTTTACCTGATGCTCGGACAACCTGATCACCGCTCTCAGGAG
GCATTGGTGCAATGGTTTATGTCGCGCTGGGAAAGTTTTGCGCCTCAGGGATATGGGCAAAACGACCGCA
AACTCTTCAGTTATCATTTGAGTGAACTGTTTTCTGACACCGCCTCAGCTGCCCCGAAAGTTAAGCTGAA
TGATGAGCTGATCCGTGAATCACGCATTAAAGCGATGAAAACACCGATACACATCCGGGTGATTAATCGT
ATTCATGACGCCCCACTGCCCGCGAGGATTGAGGATCTTAGTCTGGCGGATGCCGCCGGTCCTAGCGTAA
CACTGATGCTGAGACGTAAAAGCCCCAGTACAGTAACGGATTTGGCGATCCCGGCTTTCTACACTCGGGC
CAGCTACCACGATGTGGTTAACCCACAACTTCAGGAAGCATCGGAAGCGATGATTAACGAGGAAGCGTGG
GTGTTGAGTGACGGTAAAGCTTCGGTTAGTCAGGTTAGTTTACTGGCTGCGGCGCAAAAACTGTCCGATG
AAGCGCGCAAGTATTATCTGATGGAGTATGCCAACCAATGGGATGCATTCTTCAATGATATCAGGGTGCG
CCCAATCAACGGACTTGATGATGCGGCGCTGCTGGCAAGGCAACTCTCAGACCCGTCATCCCCGTTGGCT
AATCTGGTGCGTTTCTCCACACGGGAAATAACCCTGACCACTGACAACAATGGTAAAGGGGCGATGTCGT
CAGGCTGGTTCAATATTCAACGTAATAAGCTCACGACTGCCCGCCGTAACATCATTGACGAAATGTCGGG
TGAGCGTTCTCGTTTTCGTCTAACGCCAGAGAAAGCGGTGGAGGATCGCTTTGAACTATTAAGACGTCTG
GGATATGCCCTGCAAAGTGCGTCTACCAGCAATTCTGATCCGTTGGGCCGAACCTTCGAGCAGATTTATA
ACCAGTTGATAACACTCTCGACTTCCCTTCGGGCTGGGCAGATTTTGCCGCAAAATAACGATTTCAGTCG
CTTGCAAATCGATATGGCCCGTCAGCCAGAGCCGGTGCGCAGCATTATGATGGATCTGCTGGCCGTCGGA
CAAACGCAAAGTCTGCAACAAAGTAAGGCCAACCTCAGCAAGGGCGTCTCTTCAATTGCTTCTGATTTAT
GTAGCAACGCCGTCAGTGGCCGTTATCCCTTTAATCGGTTGGCTAGCGAAGAGATAGGTATTGGCGATTT
CAACCGTATGTTTGGTCGTTCTGGGGCGATGCAAAGCTTCTTTGATCAGAATCTCGCACCGTATGTCGAT
ACCAACGGCAACCGCTGGAAGGTAAAACCTGACAGTAACGGTGTGGTGACCCCTAAAACTCTGCGTTCGT
TTGAAAACTCAGCACAAATCCGCGACACCTTCTTTGATGCCTCCGGCAAGATGGCGATGTCGATGATCAT
TCGCCCTATCTCACTGACTCCATCAATTTTGGAAGCGGTTCTTGATGTCGATGGCCAGATTATTAACTAC
AGCCATGGTTCTAACCAACCGGTAAAAGTTGATTGGCCAGGACCGAAAGGTGGGGTGTATATCCGCCTGA
CGTTCAAAACTCAGGATGGAAATGTGGAAACCGTTAGCTTCAATGGTCCGTGGGCTATTTTCCGCATGTA
TGACGTTAGTAACCCTAGGCCACTCGGGGTCAATAGCCGTGAACTCATGATGGTGATGGATAACGTGAGT
GGCGTCTTCAAAATTGAGTTGAGTTCCACCATGAAAGATTATCCGCTGTGGTCAAAAGCATTGGCACAGT
TCTCATGTCCTAAGAATCTCTAA
 Primer design