SecReT6
Protein ID: 218928608
SecReT6 ID19
T6SS typei2
Gene symbol-
Locus tagYPO1465
StrainYersinia pestis CO92
Repliconchromosome [GenBank: NC_003143] [Browse all T6SS(s) in this replicon]
Location [Strand]1656394..1656894 [+]
Producthypothetical protein
NoteTssB
UniProt IDQ0WGV5
KEGG IDype:YPO1465
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 5.90E-56, Aligned region: 7..159
Protein Sequence: 166 a.a.     [Download]
>gi|218928608|ref|YP_002346483.1| hypothetical protein YPO1465 [Yersinia pestis CO92]
MSSSSFQNEIPKARINIKLDLHTGGAQKKVELPLKLLVMGDYSNGQEQRPLSEREKLNINKNNFNSVLAE
FQPSLKLAVPDTLAGDNTDTAVALTFREMKDFEPESVARQIPQLRALLAMRNLLRDLKSNLLDNATFRRE
LENILKDDALSDELRAELAALAPKEG
 
Nucleotide Sequence: 501 bp     [Download]
>gi|16120353|ref|NC_003143.1|:1656394-1656894 Yersinia pestis CO92 chromosome, complete genome
ATGTCCTCTTCAAGCTTCCAAAATGAGATACCTAAAGCACGCATTAACATCAAATTAGACCTGCATACTG
GCGGGGCGCAAAAGAAAGTCGAACTGCCTTTGAAGTTGTTGGTGATGGGCGATTACAGCAACGGTCAGGA
GCAGCGCCCGCTGTCTGAACGTGAAAAACTCAATATCAATAAAAATAATTTTAACAGTGTGCTGGCTGAA
TTCCAACCGAGCCTGAAACTCGCTGTACCGGACACGCTGGCCGGGGATAACACCGATACAGCCGTCGCTT
TGACCTTCCGCGAGATGAAAGATTTCGAACCGGAAAGCGTCGCCCGTCAAATCCCGCAACTGCGTGCCTT
GCTGGCCATGCGCAACCTGCTGCGAGACCTCAAATCCAATCTGCTGGACAACGCCACCTTCCGCCGTGAG
CTGGAAAATATCCTCAAAGACGATGCCTTGAGCGATGAACTGCGCGCTGAACTGGCGGCCCTGGCACCAA
AAGAGGGTTAA
 Primer design