SecReT6
Protein ID: 218928610
SecReT6 ID19
T6SS typei2
Gene symbol-
Locus tagYPO1467
StrainYersinia pestis CO92
Repliconchromosome [GenBank: NC_003143] [Browse all T6SS(s) in this replicon]
Location [Strand]1658499..1659851 [+]
Producthypothetical protein
NoteTssK
UniProt IDQ74QK3
KEGG IDype:YPO1467, ypm:YP_3463
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.50E-133, Aligned region: 18..447
Protein Sequence: 450 a.a.     [Download]
>gi|218928610|ref|YP_002346485.1| hypothetical protein YPO1467 [Yersinia pestis CO92]
MKIERPLWTRGVLISPQQFQQQASWEAWTNECIAQMAVMHPWGVLQATFELDALAQGRLKAARLHVRFQD
GVLVDTECADVLPPTLTLAASLPVEASDATVMLAIPQLYANGGNCLQPDERGERPVRHRQAWRDVQNQFG
DDKKQVAVMYHQLTLRLDTQENGDYQVCPVARLLRDAQGRWTLDPGFIPPMLSLQASAWCGEQLELLMVQ
LRARLQRLMGMRRESNARMADFAVADVSLFWLLNALNSAEPVLGNFQRYPQVHPERLYQELARLAGSLLT
FSLEHEVTAIPVYQHEQLTRVFPPLFALLNILLEASLPSRVVAIELVHEPRINQWRATLRDPRLREGADF
YLSVRSSLPAAQLQTQFPQLCKAGAPDEVGNVVNVALSGIPLRPLSHVPAAIPLRLENQYFSLDLSHPAA
TQMMETGACVFYVPGTLGEIQLELFAVLRA
 
Nucleotide Sequence: 1353 bp     [Download]
>gi|16120353|ref|NC_003143.1|:1658499-1659851 Yersinia pestis CO92 chromosome, complete genome
ATGAAGATTGAACGTCCTCTGTGGACTCGCGGAGTTTTGATTTCCCCGCAGCAATTTCAACAACAGGCCT
CCTGGGAGGCCTGGACCAATGAATGCATCGCTCAAATGGCCGTGATGCATCCCTGGGGCGTGCTTCAGGC
CACTTTTGAATTGGATGCATTGGCACAGGGCCGCCTGAAAGCGGCGCGTTTGCATGTGCGTTTTCAGGAC
GGTGTGCTGGTGGATACCGAGTGTGCTGATGTGCTGCCGCCCACGCTGACGCTGGCAGCCAGTCTGCCCG
TCGAGGCCAGCGACGCCACGGTGATGCTGGCGATACCACAACTGTATGCCAATGGCGGTAACTGCCTGCA
GCCGGATGAGCGGGGCGAACGCCCGGTACGCCATCGTCAGGCCTGGCGCGATGTCCAAAATCAGTTCGGC
GATGACAAAAAGCAGGTCGCGGTGATGTACCACCAACTGACCCTGCGGCTGGACACTCAGGAAAACGGCG
ATTATCAGGTCTGCCCGGTGGCGCGCTTGCTGCGGGATGCGCAAGGTCGCTGGACACTGGATCCGGGCTT
TATTCCGCCGATGCTGAGCCTGCAGGCCAGTGCCTGGTGTGGCGAACAGCTTGAGTTATTGATGGTGCAA
CTGCGGGCGCGTTTACAGCGTCTGATGGGGATGCGCCGGGAGAGCAATGCACGGATGGCCGATTTTGCTG
TCGCGGATGTGTCGCTGTTCTGGCTGCTCAATGCCCTTAACAGTGCCGAACCGGTACTGGGGAATTTTCA
GCGCTATCCGCAGGTTCATCCAGAGCGCCTGTATCAGGAGCTGGCCAGGCTGGCGGGCAGCCTGCTGACG
TTCTCCCTTGAGCACGAAGTGACGGCGATCCCGGTTTATCAGCATGAACAACTGACCCGCGTCTTTCCCC
CGTTGTTTGCCCTGCTGAATATTCTGCTGGAAGCCAGCCTCCCATCACGGGTGGTGGCGATTGAGCTGGT
TCATGAACCGCGTATCAATCAGTGGCGCGCGACCCTGCGTGACCCTCGTCTGCGCGAAGGGGCCGATTTC
TACCTGTCGGTCCGTTCCTCGTTGCCCGCGGCCCAATTGCAGACTCAGTTCCCGCAGTTGTGTAAAGCCG
GTGCGCCAGATGAGGTCGGTAACGTGGTGAATGTCGCGTTGAGCGGGATCCCACTGCGTCCGCTGAGCCA
TGTCCCAGCCGCCATCCCCTTGCGGCTGGAAAACCAGTACTTCTCCCTTGATCTCAGCCACCCTGCGGCG
ACGCAGATGATGGAGACGGGGGCCTGTGTGTTCTATGTACCCGGTACGCTGGGTGAGATCCAACTGGAGC
TGTTTGCGGTGCTACGCGCATGA
 Primer design