SecReT6
Protein ID: 218928622
SecReT6 ID19
T6SS typei2
Gene symbol-
Locus tagYPO1482
StrainYersinia pestis CO92
Repliconchromosome [GenBank: NC_003143] [Browse all T6SS(s) in this replicon]
Location [Strand]1677882..1681304 [+]
Producthypothetical protein
NoteTssM
UniProt IDQ7CHN7
KEGG IDype:YPO1482, ypk:y2688, ypm:YP_1371
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 3.70E-75, Aligned region: 84..122
IcmF-related [PF06761], Evalue: 3.70E-75, Aligned region: 418..736
IcmF-related [PF06761], Evalue: 3.70E-75, Aligned region: 1053..1096
DUF1215 [PF06744], Evalue: 2.30E-38, Aligned region: 859..980
Bacillus_PapR [PF05968], Evalue: 0.0061, Aligned region: 371..409
Protein Sequence: 1140 a.a.     [Download]
>gi|218928622|ref|YP_002346497.1| hypothetical protein YPO1482 [Yersinia pestis CO92]
MKRIALPIKKPEVWFWIVALLFLLAGAVLCWLVWQHPERVGLIPGTPQRDRWLTGLVVGTGILTLCALLS
YAGTRLSGRKHFDELRQQAQGDDAPLPEDNAQAGETQQGEPSRLKTRLRRRYGLFWRDKVRLLMVVGEPD
EIAALAPQLAEQGWLEGQRTVLIHGGSLQRPADETGLSEWRKLRRGRPLDGIVWAMTAAQSGTPQWMDNG
LRTLEKMGAALRYQPPVYLWQVCDSDWPQDSRTEQPVGAVFPAKATPEKVEQQLRALLPQLREQGMQQLS
IEPHHDFLLRLAQSLDQGDAARWRQRLTPWFTEYAARIPLRGLMFSLPDTSASAAQVHEKSWTVPASWQG
VLDDCRGARGRRVGLPWEQTLCYSLLALIVLWGVGSVVSFAVNRHQMVSAAQQAQQLAQSHAVSDQQLMA
LQALRNDIGRLQSRVAQGAPWYQRFGLDHNAPLLEVLMPWYGQANNRILRDATAQSLYQKLSELAELPAN
SPQRAARAKTGYDQLKAYLMMARPEKADAVFYAQVMQTTEPTRAGVSPGLWQSLAPDLWQFYAQNLPAQP
DWKITPDTGLISQVRQVLLGQMGQRNAESTLYENMLLSVRRNYADMTLMDMTGDTDAQRLFQTSESVPGM
FTRKAWDEQIQQAIDKTVASRREEIDWVLSDNRRAISEDISPEALKKRLTERYFTDFAGSWLSFLNSLHW
NEAHNLSDVIDQLTLMSDVRQSPLIALMNTLAWQGQTGQQNQALSDSLVKSAKALMNKDQAPAIDQSAGG
PVGPLDETFGPLLALMGKGDAQNRLSSDSSLSLQTLLTRVTRVRLKLQQVVNASDPQEMTQVLAQTVFQG
KSVDLTDTQEYGSLIAASLGEEWSSFGQTMFVQPLTQAWETVLQPSSASLNDQWKNAVVANWKSAFDGRY
PFAASKSDASLPMLAEFIRKDSGRIDSFLTRELGGVLHKEGTRWVPNKVNSQGLTFNPAFLAAINQLSQI
SDILFTDGSQGLRFELLARPVPNVVETNLAIDGQKLHYFNQMESWQSFRWPGETYKPGTMLTWTGVSSGA
RLYGDYQGTWGLIRWLEQAKQKKLDEGRYQLTFTTADKQPLQWILRTELGKGPLGLLQLRNFTLPAQIFL
IQHAPLAIADMSDDEDMAED
 
Nucleotide Sequence: 3423 bp     [Download]
>gi|16120353|ref|NC_003143.1|:1677882-1681304 Yersinia pestis CO92 chromosome, complete genome
GTGAAGCGCATTGCCTTACCGATTAAAAAGCCAGAAGTCTGGTTCTGGATTGTTGCCCTGCTGTTTTTGC
TGGCCGGTGCCGTGTTGTGCTGGCTGGTCTGGCAACACCCCGAACGGGTGGGGTTAATTCCGGGGACACC
GCAACGTGACCGTTGGCTGACGGGACTGGTGGTGGGAACGGGGATCCTGACCCTGTGCGCATTACTGTCG
TATGCGGGGACCCGGTTATCCGGCAGAAAACACTTTGATGAGCTACGGCAGCAGGCACAGGGCGATGATG
CGCCGTTGCCGGAAGACAACGCGCAGGCGGGTGAGACTCAGCAGGGTGAACCGTCCCGCCTAAAAACCCG
CCTGCGCCGCCGTTACGGTCTGTTCTGGCGCGACAAAGTCCGGCTGCTGATGGTGGTGGGTGAACCTGAC
GAAATCGCCGCGCTGGCCCCGCAACTGGCGGAGCAGGGCTGGCTGGAAGGGCAGCGCACGGTGTTGATAC
ACGGTGGCAGTTTACAACGTCCGGCGGATGAAACCGGGCTGAGTGAGTGGCGCAAACTGCGCCGTGGCCG
CCCGTTGGATGGCATTGTCTGGGCGATGACCGCCGCGCAGAGTGGCACGCCACAGTGGATGGATAACGGC
CTGCGAACGCTGGAAAAAATGGGTGCCGCCTTGCGCTATCAACCGCCGGTGTATCTGTGGCAGGTCTGTG
ACAGCGACTGGCCTCAGGATTCGCGGACGGAGCAGCCGGTCGGGGCGGTGTTCCCGGCGAAGGCTACGCC
AGAAAAGGTGGAGCAGCAACTGCGTGCCCTGTTGCCTCAGTTACGTGAACAGGGAATGCAGCAGCTTTCC
ATCGAGCCGCACCATGATTTCTTGTTGCGTCTGGCGCAGTCACTGGATCAGGGCGATGCGGCTCGCTGGC
GGCAGCGTCTGACGCCGTGGTTTACCGAGTATGCCGCGCGTATTCCCTTGCGTGGGCTGATGTTCAGTTT
ACCCGATACCTCTGCATCGGCGGCGCAGGTACATGAGAAAAGCTGGACGGTACCGGCCAGTTGGCAGGGG
GTACTGGATGATTGCCGGGGGGCGCGTGGACGCCGTGTCGGGCTGCCGTGGGAGCAGACACTGTGCTACA
GCTTGCTGGCACTGATTGTCTTGTGGGGTGTGGGCAGCGTGGTGTCATTTGCGGTCAACCGCCACCAGAT
GGTCTCTGCCGCACAACAAGCACAGCAACTGGCGCAGTCGCACGCGGTCTCCGACCAGCAACTGATGGCC
CTACAAGCCCTGCGAAATGATATCGGGCGCTTACAATCTCGCGTGGCGCAGGGCGCGCCGTGGTATCAGC
GCTTTGGTCTGGACCATAATGCGCCGCTGCTTGAGGTCCTGATGCCGTGGTATGGTCAGGCCAACAACCG
TATTCTCAGGGATGCCACCGCGCAGAGCCTGTATCAGAAACTCAGCGAACTGGCGGAGCTGCCCGCCAAC
AGCCCGCAACGGGCAGCACGGGCAAAAACAGGCTATGACCAGTTAAAGGCTTATCTGATGATGGCCCGCC
CGGAAAAAGCCGATGCTGTATTTTATGCTCAGGTGATGCAGACCACCGAGCCTACACGGGCCGGTGTCTC
CCCCGGTCTGTGGCAGAGTCTGGCGCCCGACTTGTGGCAGTTTTATGCACAAAATCTGCCCGCTCAGCCG
GACTGGAAAATTACCCCGGATACCGGGTTGATCAGCCAGGTGCGGCAGGTGTTGCTGGGGCAGATGGGTC
AGCGCAATGCAGAAAGTACGCTGTATGAAAACATGCTGCTGTCGGTGCGCCGCAACTATGCCGACATGAC
GCTGATGGACATGACCGGCGATACCGATGCTCAGCGTCTGTTTCAGACCTCGGAATCCGTGCCCGGTATG
TTCACCCGCAAGGCCTGGGATGAGCAAATCCAGCAGGCGATAGATAAAACGGTGGCCTCCCGCCGCGAAG
AAATTGACTGGGTATTGAGTGATAACCGCCGGGCGATATCCGAAGATATCTCACCGGAAGCGCTGAAAAA
ACGCCTGACCGAACGTTATTTCACCGATTTTGCTGGCAGTTGGCTGAGTTTCCTCAACAGTTTGCACTGG
AATGAGGCGCATAACCTGTCGGATGTGATTGACCAACTGACCTTGATGAGTGATGTACGCCAGTCGCCGC
TGATTGCGCTAATGAACACGCTGGCGTGGCAAGGGCAGACCGGGCAGCAGAATCAGGCATTATCGGATTC
GCTGGTGAAGTCTGCCAAGGCGCTGATGAATAAAGACCAGGCTCCGGCGATTGACCAGAGTGCCGGTGGG
CCAGTAGGGCCACTGGACGAGACCTTTGGCCCGTTGCTGGCACTGATGGGCAAAGGCGATGCACAAAACA
GGCTGTCGTCGGACAGCTCGCTGAGCCTGCAAACGTTGCTCACCCGCGTGACCCGGGTGCGGCTTAAACT
CCAGCAGGTGGTCAATGCTTCGGATCCGCAGGAGATGACACAGGTGCTGGCCCAGACCGTTTTCCAGGGC
AAAAGTGTTGATCTGACGGACACGCAGGAGTACGGCAGCCTGATAGCCGCCAGTCTGGGAGAGGAGTGGA
GCAGCTTCGGGCAGACGATGTTTGTTCAGCCGCTGACGCAGGCGTGGGAAACCGTGCTGCAACCTTCATC
GGCCAGTCTCAACGACCAGTGGAAAAACGCGGTGGTGGCCAACTGGAAATCGGCCTTTGATGGCCGCTAT
CCGTTTGCCGCCAGTAAAAGTGATGCTTCATTGCCGATGCTGGCCGAGTTTATCCGCAAGGACAGCGGGC
GCATCGACAGCTTCCTGACCCGTGAACTGGGCGGCGTGCTGCACAAAGAAGGAACGCGCTGGGTGCCGAA
TAAGGTGAACAGCCAGGGGCTGACCTTTAACCCGGCCTTCCTGGCGGCGATTAATCAACTGAGCCAAATC
TCCGACATCTTGTTCACTGACGGCAGTCAGGGGCTACGCTTTGAGCTGCTGGCCCGTCCGGTGCCGAATG
TGGTGGAAACGAATCTGGCGATTGACGGACAGAAATTGCATTATTTCAACCAGATGGAGAGCTGGCAGAG
TTTCCGCTGGCCGGGGGAGACCTATAAACCCGGCACGATGTTGACCTGGACTGGTGTGAGTTCAGGCGCC
CGGTTGTACGGTGATTATCAGGGGACATGGGGGCTGATCCGTTGGCTGGAGCAGGCAAAACAGAAAAAGC
TGGATGAAGGGCGCTATCAACTGACCTTCACCACCGCAGATAAACAGCCATTGCAATGGATATTACGCAC
CGAGCTGGGCAAAGGCCCGTTAGGCCTGTTGCAACTGCGTAATTTCACTCTGCCTGCGCAAATTTTTCTG
ATACAGCACGCGCCGCTTGCGATTGCTGACATGTCAGACGATGAAGACATGGCAGAAGACTGA
 Primer design