SecReT6
Protein ID: 218928623
SecReT6 ID19
T6SS typei2
Gene symbol-
Locus tagYPO1483
StrainYersinia pestis CO92
Repliconchromosome [GenBank: NC_003143] [Browse all T6SS(s) in this replicon]
Location [Strand]1681348..1682949 [+]
Producthypothetical protein
NoteTssA
UniProt IDQ7CHN8
KEGG IDype:YPO1483, ypk:y2687
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.40E-20, Aligned region: 69..126
ImpA-rel_N [PF06812], Evalue: 1.40E-20, Aligned region: 157..182
ImpA-rel_N [PF06812], Evalue: 1.40E-20, Aligned region: 302..315
ImpA-rel_N [PF06812], Evalue: 1.40E-20, Aligned region: 354..364
Protein Sequence: 533 a.a.     [Download]
>gi|218928623|ref|YP_002346498.1| hypothetical protein YPO1483 [Yersinia pestis CO92]
MATLTTLLTACAAEPEPLLQQARQQVALWERWLQPVTPDKHTGEDPGYDDHFQQMREEVNKLSGADTTLT
CELAEKLFTTHGKDVRVATYYVWARLHRDGEAGLADGLSLLAGLITRFGEGLHPLRTTSRKTALEWLAGS
RMRDSLSLYPEVDKADFERIVGALALIEQRLSLWDEGVRPQLGGLYTALENRLAQSGGLNAVVPQNSSGS
SSAGSLNPANTASPALRPVQSGRDLLDQTKTLAKYLRNQPQGWLSGHHLIKSVRWDTVHQSPPLDVNGRT
RLVPPRPEYRVQLKRLYLQQNWLALLEQAESIFAEGVNHFWLDVQWYLHQALSKAGAPFDGWASCITQDL
RLLLTRLPGLEGLCWSDGTPFADEVTLGWINQQVLESVSGWGSEPAAVSSGEDGILLLEPEALAQADSEG
IEAALNWLQSRPGITTARHQWLLRLVMARVAEQYGKNDMALHLLSGLDSSGALLTLPQWEPGLVFEVKAR
RLKLLRMKAQRGDSDKTRLHAEMESLLSGLIALDPARAAVLCG
 
Nucleotide Sequence: 1602 bp     [Download]
>gi|16120353|ref|NC_003143.1|:1681348-1682949 Yersinia pestis CO92 chromosome, complete genome
ATGGCGACGTTAACTACCTTGCTCACCGCTTGTGCCGCAGAGCCTGAGCCACTTTTACAGCAGGCCAGAC
AACAGGTTGCGCTCTGGGAACGTTGGTTGCAACCGGTGACACCCGATAAGCATACCGGTGAAGACCCCGG
TTACGATGACCACTTCCAACAGATGCGTGAAGAGGTCAATAAGCTCTCGGGTGCCGATACCACGCTGACC
TGCGAGCTGGCTGAAAAGCTGTTCACCACACACGGCAAGGATGTGCGGGTGGCAACCTATTACGTCTGGG
CGCGGTTGCACCGTGACGGCGAGGCCGGGCTGGCGGATGGCCTTTCCCTGCTGGCCGGGCTGATCACGCG
CTTTGGTGAGGGCCTGCATCCGCTGCGTACAACCAGCCGGAAAACCGCGTTGGAGTGGCTGGCCGGCTCC
CGGATGCGCGACAGCTTGTCACTTTACCCGGAAGTGGATAAAGCCGATTTTGAGCGTATCGTGGGCGCAC
TGGCCCTTATCGAACAGAGGCTCAGTCTCTGGGACGAAGGCGTCCGGCCGCAACTGGGCGGGTTGTATAC
CGCCCTGGAAAACCGCCTCGCGCAATCTGGTGGGCTAAATGCCGTGGTGCCGCAAAACAGCAGCGGGTCA
TCATCGGCAGGCAGCTTGAACCCAGCCAACACGGCGTCACCGGCGTTGCGGCCAGTGCAATCGGGACGTG
ACCTGCTCGATCAGACCAAAACGCTGGCAAAATACCTGCGCAACCAGCCGCAGGGCTGGCTCTCCGGGCA
TCATCTTATCAAAAGCGTGCGCTGGGATACGGTACATCAGTCACCGCCATTAGATGTGAACGGACGGACC
CGGCTGGTACCGCCGCGCCCGGAATATCGCGTACAACTCAAGCGCCTTTATCTGCAACAAAACTGGCTGG
CGTTGCTGGAACAGGCCGAATCGATATTTGCCGAAGGGGTTAACCATTTCTGGCTCGATGTGCAGTGGTA
TCTGCATCAGGCCCTCAGCAAAGCGGGGGCCCCATTCGATGGCTGGGCGAGCTGTATCACGCAGGATTTA
CGGTTATTACTGACCCGGCTGCCGGGGCTGGAAGGGCTATGCTGGAGTGACGGCACGCCATTTGCCGATG
AGGTGACGCTGGGGTGGATAAACCAGCAGGTACTGGAGTCGGTCTCGGGCTGGGGCAGCGAGCCGGCCGC
CGTTTCATCCGGTGAGGATGGCATTCTGTTGCTGGAGCCAGAAGCTTTGGCTCAGGCGGACAGCGAAGGA
ATTGAAGCGGCGCTTAACTGGTTGCAGTCACGACCGGGGATCACCACGGCGCGCCATCAGTGGCTGCTGC
GTCTGGTGATGGCCCGGGTGGCGGAGCAGTACGGTAAGAACGATATGGCCTTGCATCTGCTGAGTGGCCT
TGATAGCAGCGGCGCGTTGTTGACCTTGCCACAGTGGGAGCCGGGGTTGGTGTTTGAAGTTAAAGCCCGC
CGTTTGAAGCTGTTGCGTATGAAGGCACAGCGGGGTGACAGTGATAAAACCCGCCTGCATGCTGAAATGG
AAAGCCTGCTCAGTGGGCTTATCGCCCTCGACCCGGCCCGTGCGGCCGTATTATGCGGATAA
 Primer design