SecReT6
Protein ID: 218928624
SecReT6 ID19
T6SS typei2
Gene symbol-
Locus tagYPO1484
StrainYersinia pestis CO92
Repliconchromosome [GenBank: NC_003143] [Browse all T6SS(s) in this replicon]
Location [Strand]1682940..1684025 [+]
Producthypothetical protein
NotePAAR
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Toxin_60 [PF15607], Evalue: 6.40E-28, Aligned region: 203..312
PAAR_motif [PF05488], Evalue: 3.70E-10, Aligned region: 19..74
Protein Sequence: 361 a.a.     [Download]
>gi|218928624|ref|YP_002346499.1| hypothetical protein YPO1484 [Yersinia pestis CO92]
MRITEKEQTMAKGYYLGVGDETTCGGVIIEGDATHVLMGKAVAREQDRVTCGKHPGTYIIIGHVPGDSVN
GRKFAGTLNSQSNCPCKAWFIPSLVHDTYEFGARSKSQNMSEISTEVEREMVENVSESEEKSKVVCAHID
GALVVASYILDEIKKNVKSDTADKIRSFIDNDLYKKRLKEWQDSPWYARMNAPPQPEIISASVLWFMAVK
SGAKWDHKPKIRDQFKAYAVSRPLVGSGTRSKSYFHKYEEHDYFYDVWSNIHYGYVGLSLGFDESYLLLG
STLEQVRTSIGSKPDPIDDITCMKIGYALYHQHGKYAETLDVRHILDALESASDLDLAISRQIHWCWNND
NSSQIDHPQGK
 
Nucleotide Sequence: 1086 bp     [Download]
>gi|16120353|ref|NC_003143.1|:1682940-1684025 Yersinia pestis CO92 chromosome, complete genome
ATGCGGATAACAGAGAAGGAACAGACAATGGCAAAAGGCTATTACCTTGGGGTTGGGGATGAAACAACCT
GCGGCGGCGTGATCATCGAAGGTGACGCCACACATGTCTTGATGGGTAAAGCGGTGGCCCGTGAACAAGA
CAGAGTGACCTGCGGTAAACATCCGGGAACCTATATTATTATCGGCCATGTTCCTGGCGATTCGGTAAAT
GGCCGCAAGTTTGCGGGCACCTTGAATAGTCAAAGCAATTGCCCGTGCAAGGCGTGGTTTATTCCTTCTT
TGGTGCATGATACGTATGAGTTTGGTGCAAGAAGTAAATCACAAAATATGTCTGAAATTAGTACTGAAGT
CGAACGTGAGATGGTAGAAAATGTGAGTGAATCAGAAGAAAAATCTAAAGTTGTCTGTGCCCATATTGAT
GGCGCTTTAGTAGTAGCGAGTTATATCCTTGATGAAATAAAGAAAAATGTAAAAAGTGATACCGCTGATA
AAATCAGATCTTTTATCGATAATGACCTCTATAAAAAAAGACTTAAGGAGTGGCAGGATTCTCCTTGGTA
CGCGAGAATGAATGCACCTCCACAGCCTGAAATAATATCGGCATCGGTTTTATGGTTTATGGCGGTCAAG
AGTGGTGCTAAATGGGATCATAAACCTAAAATTAGAGATCAATTTAAAGCATATGCAGTTTCTCGTCCTC
TGGTCGGAAGCGGAACCCGATCAAAAAGCTATTTTCATAAATATGAAGAACATGATTATTTTTATGATGT
CTGGTCCAATATTCACTATGGTTATGTAGGCTTAAGTCTTGGTTTTGATGAGTCATATTTATTACTTGGC
TCAACTCTTGAGCAAGTAAGAACCAGCATCGGGAGTAAACCAGATCCTATAGATGATATTACATGTATGA
AAATTGGCTATGCACTCTATCATCAACATGGAAAATATGCTGAGACGTTAGATGTCAGGCATATACTCGA
TGCTCTTGAATCAGCATCGGACCTTGATCTAGCTATTTCAAGACAAATTCATTGGTGTTGGAATAATGAT
AATTCGAGTCAAATTGATCACCCGCAGGGTAAGTAA
 Primer design