SecReT6
Protein ID: 218928626
SecReT6 ID19
T6SS typei2
Gene symbol-
Locus tagYPO1485
StrainYersinia pestis CO92
Repliconchromosome [GenBank: NC_003143] [Browse all T6SS(s) in this replicon]
Location [Strand]1684716..1686479 [+]
Producthypothetical protein
NoteTssF
UniProt IDQ7CHP0
KEGG IDype:YPO1485, ypk:y2684, ypm:YP_1375
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.00E-183, Aligned region: 6..583
Protein Sequence: 587 a.a.     [Download]
>gi|218928626|ref|YP_002346501.1| hypothetical protein YPO1485 [Yersinia pestis CO92]
MDDLTLRYFDAEMRYLREAGEEFARAHPDRAAGLNLDKAGARDPYVERLFEGFAFLMGRLREKLDDDLPE
LTEGLVSLLWPHYLRTIPSLSIVEFTPQWQGMKERMGVSKGFEVLSRPIGERETRCRYTTTQEMDLLPLT
LRRAGLDSEPDGRSVIRLRFDCSALADWSRINLSRLPLYFDADAPLACALHEALTLNTAKLWIRLPGQAD
RQPLDGHFAPLGFGEQDTLWPKADSAFSGYQLLLEYFTFREKFMFVALQGLDGIELPAELPWFEIDVVLE
KRWQHDFSFSEKNLRLHCVPVINLFPLESDPLSLSSLQTEYLLRPMRIQDGYTEVYSVDSVISSRHTGHQ
VYVPFTSFRHKGGMLRHDAPEYYYHTRVKRGPSGLHDTWLVLGGEAFDNHSVPDNENLSLSLTGTNGQLP
RKALQSTVLDTAVKSTGAQVRVRNLSAPSLPCYPPNRDRFHWRVLSHLGSSFLWMMDNAEVLRGTLALYD
WTDNEMNRRRLEAIAEVKHSEIERFERGYLLRGVHIEITLDSNGFTGTGDICLFGEMLSRFFALYTDIHL
FNRLTLILQPTGERLEWEENHQSRLPG
 
Nucleotide Sequence: 1764 bp     [Download]
>gi|16120353|ref|NC_003143.1|:1684716-1686479 Yersinia pestis CO92 chromosome, complete genome
ATGGACGACTTAACCCTGCGTTATTTTGACGCTGAAATGCGCTACCTGCGCGAAGCGGGCGAAGAGTTTG
CTCGTGCGCACCCTGATCGGGCTGCCGGATTAAATCTGGATAAAGCCGGGGCGCGTGACCCCTATGTCGA
ACGCCTATTTGAAGGCTTTGCCTTTCTGATGGGCCGACTGCGGGAAAAACTGGATGACGACCTGCCGGAA
CTGACCGAAGGGTTGGTCAGCCTGCTGTGGCCGCACTACCTGCGTACCATTCCGTCGCTTTCTATTGTGG
AGTTCACCCCACAATGGCAGGGGATGAAAGAGCGCATGGGGGTGAGTAAAGGTTTTGAAGTGCTGTCCCG
CCCCATTGGTGAACGTGAAACCCGTTGCCGCTATACCACCACGCAAGAGATGGACCTGCTCCCGCTGACC
CTGCGCCGTGCCGGGCTGGACAGTGAACCCGATGGCCGGTCGGTTATCCGGCTGCGCTTTGATTGCAGCG
CGCTGGCCGACTGGAGCCGTATCAACCTGAGCCGCCTGCCGCTCTATTTTGATGCCGATGCGCCGCTGGC
CTGCGCCCTGCATGAGGCGCTGACCCTGAATACCGCCAAACTCTGGATCCGTTTGCCGGGGCAGGCTGAT
CGCCAGCCGCTGGACGGCCATTTCGCGCCGCTGGGGTTCGGGGAGCAGGATACACTGTGGCCGAAGGCCG
ACAGTGCGTTCAGTGGTTATCAGCTCTTGCTGGAGTACTTTACCTTCCGCGAAAAGTTTATGTTTGTCGC
GTTGCAGGGGCTGGATGGGATCGAGCTGCCGGCGGAACTGCCGTGGTTTGAGATTGATGTGGTGCTGGAA
AAACGCTGGCAACATGATTTCTCGTTCTCCGAAAAGAACCTGCGCCTGCATTGTGTGCCGGTGATTAACC
TGTTCCCGCTGGAATCGGACCCGCTGTCACTTTCTTCATTACAGACCGAATACCTGCTGCGCCCAATGCG
CATTCAGGACGGTTATACCGAAGTGTATTCGGTGGACTCGGTGATCTCCTCCCGTCATACCGGGCATCAG
GTCTATGTCCCTTTCACCAGCTTTCGCCACAAGGGGGGGATGTTGCGCCATGATGCGCCGGAGTATTACT
ACCATACGCGGGTCAAACGCGGGCCTTCGGGGTTACACGATACCTGGCTGGTGCTGGGGGGCGAGGCGTT
TGATAACCACAGCGTACCGGATAATGAAAATTTGTCGCTGAGCCTGACCGGCACCAACGGGCAGTTACCG
CGTAAAGCGCTGCAAAGCACGGTGCTGGATACGGCGGTGAAATCCACCGGGGCTCAGGTGCGGGTGCGTA
ATCTCTCCGCGCCGTCATTGCCATGCTACCCGCCGAACCGCGACCGTTTTCACTGGCGGGTGCTGAGCCA
TCTGGGCAGTAGTTTTCTGTGGATGATGGATAACGCCGAAGTGCTGCGCGGCACGCTGGCGCTGTATGAC
TGGACGGACAACGAAATGAACCGCCGTCGGCTGGAGGCGATCGCCGAGGTCAAACACAGCGAGATTGAAC
GCTTTGAGCGGGGCTATTTGCTGCGCGGGGTGCACATTGAAATCACCCTCGACAGCAACGGCTTTACCGG
TACCGGGGATATTTGTCTGTTTGGGGAAATGCTCAGTCGCTTCTTTGCCCTGTATACCGATATTCACCTG
TTTAATCGTCTGACTCTGATACTGCAACCGACAGGAGAACGTTTGGAATGGGAAGAGAATCATCAGTCCC
GCCTTCCCGGCTAA
 Primer design