SecReT6
Protein ID: 218928627
SecReT6 ID19
T6SS typei2
Gene symbol-
Locus tagYPO1486
StrainYersinia pestis CO92
Repliconchromosome [GenBank: NC_003143] [Browse all T6SS(s) in this replicon]
Location [Strand]1686443..1687528 [+]
Producthypothetical protein
NoteTssG
UniProt IDQ7CHP1
KEGG IDype:YPO1486, ypk:y2683, ypm:YP_1376
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 3.70E-81, Aligned region: 19..319
Protein Sequence: 361 a.a.     [Download]
>gi|218928627|ref|YP_002346502.1| hypothetical protein YPO1486 [Yersinia pestis CO92]
MGRESSVPPSRLITRLKRDIGQINFYRFCQLLEQQPGTLPLGSTNSPADDPVRFRPHPGMGFPVSELKAL
ENDPLHPEAPLTARTTFMGLYGVDSPLPTAYIDDITQQREGHEALEGFLDIFNHRFMTQFYRIWRKYSYP
ATFESGGTDNTSQSLLGLIGMGIPGSQQHFATPTSRFLALLGVMRQPGRTAEGVQALVRLLAPFTEADVT
PHCLRTVRLTSPMAFADEGANWLDGYTVLGDEAIDANSQLLISLRTADRDEAANWLPDGPLYTDFLVLLR
VYLGWRYRACIQLTVATRLLPALVLDETPIRLGLTGVLGLDDATLSDDIPEYFTVALGHYRGLAPQQHQE
GNRRVNYRLEK
 
Nucleotide Sequence: 1086 bp     [Download]
>gi|16120353|ref|NC_003143.1|:1686443-1687528 Yersinia pestis CO92 chromosome, complete genome
ATGGGAAGAGAATCATCAGTCCCGCCTTCCCGGCTAATCACCCGGCTTAAGCGCGATATCGGCCAGATCA
ATTTTTACCGTTTCTGTCAGTTGCTGGAGCAACAACCGGGAACCTTGCCGCTCGGCAGTACCAACAGCCC
GGCGGATGATCCGGTGCGTTTTCGTCCGCATCCCGGCATGGGTTTTCCGGTCAGTGAACTGAAGGCGCTG
GAAAACGACCCGCTGCATCCGGAAGCCCCGTTGACCGCGCGCACCACCTTTATGGGGTTGTACGGGGTGG
ATTCGCCTTTGCCGACGGCCTATATCGACGATATCACCCAGCAGCGCGAAGGGCATGAGGCGCTGGAAGG
GTTCCTCGATATTTTCAACCACCGTTTTATGACGCAGTTTTATCGCATCTGGCGCAAATATTCCTATCCG
GCCACTTTTGAGTCGGGCGGCACAGACAATACCTCTCAGAGCCTGTTGGGGCTGATAGGCATGGGTATTC
CTGGCTCACAGCAGCATTTTGCCACCCCGACATCGCGCTTTCTGGCCTTGCTGGGGGTGATGCGACAACC
GGGGCGCACTGCCGAAGGGGTACAGGCGCTGGTCCGGCTGCTGGCCCCGTTTACCGAGGCGGATGTCACG
CCCCATTGCCTGCGCACGGTGCGCCTGACTTCTCCGATGGCGTTTGCCGATGAAGGGGCCAACTGGCTGG
ACGGCTACACCGTGCTGGGTGATGAGGCCATTGATGCCAACAGTCAGTTGCTGATTTCGCTGCGCACGGC
AGACCGCGACGAGGCCGCTAACTGGTTACCGGATGGCCCGCTGTATACCGATTTTCTGGTGCTGTTGCGG
GTCTATCTGGGCTGGCGTTACCGGGCCTGTATCCAACTGACGGTCGCCACCCGGTTGCTGCCGGCGTTGG
TGTTGGATGAGACACCGATAAGGCTGGGATTAACCGGCGTGCTGGGGCTGGATGACGCGACGCTGTCAGA
CGATATACCTGAATATTTTACCGTGGCGCTGGGCCACTACCGTGGGCTGGCTCCACAGCAACATCAAGAA
GGAAACCGACGTGTTAACTACCGTTTGGAAAAATAA
 Primer design