SecReT6
Protein ID: 218928628
SecReT6 ID19
T6SS typei2
Gene symbol-
Locus tagYPO1487
StrainYersinia pestis CO92
Repliconchromosome [GenBank: NC_003143] [Browse all T6SS(s) in this replicon]
Location [Strand]1687596..1688084 [+]
Producthypothetical protein
NoteTssJ
UniProt IDQ0WGT5
KEGG IDype:YPO1487
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 4.50E-39, Aligned region: 2..155
Protein Sequence: 162 a.a.     [Download]
>gi|218928628|ref|YP_002346503.1| hypothetical protein YPO1487 [Yersinia pestis CO92]
MLLSGCGLTQAVTDSTVSATKSLFYKQIKVLHLDFTAREALNTDAHEANSSSEPVMVRVYQLRDDKTFLK
TVYQQLASDGEAALKDDLLASRSVVVKPGGAVTLDMPMEKETQFVAVVALFRHPDMAKDHWRLILTLDDL
HPDKPRTLELGNNSLTLRTEKK
 
Nucleotide Sequence: 489 bp     [Download]
>gi|16120353|ref|NC_003143.1|:1687596-1688084 Yersinia pestis CO92 chromosome, complete genome
TTGTTGCTCAGTGGCTGCGGGCTGACGCAAGCCGTGACCGATAGCACCGTGTCGGCCACAAAATCACTGT
TTTATAAGCAGATAAAGGTGCTGCATCTGGACTTTACCGCCCGTGAAGCCCTGAATACCGATGCGCACGA
GGCGAACTCGTCATCGGAGCCGGTAATGGTGCGGGTTTATCAGTTACGTGATGATAAAACCTTCCTCAAA
ACGGTGTATCAACAACTGGCAAGCGACGGGGAGGCGGCGCTTAAAGATGACCTGCTGGCCAGCCGCAGTG
TGGTGGTGAAACCGGGCGGGGCGGTAACACTGGATATGCCGATGGAAAAAGAGACCCAGTTTGTGGCAGT
GGTGGCGCTGTTCCGTCATCCGGATATGGCCAAAGACCACTGGCGTCTGATACTCACGCTGGACGACCTG
CATCCCGATAAGCCCCGTACCCTTGAGTTGGGTAATAACAGCCTGACCCTGCGGACGGAGAAAAAATAA
 Primer design