SecReT6
Protein ID: 218929795
SecReT6 ID20
T6SS typeN/A
Gene symbol-
Locus tagYPO2723
StrainYersinia pestis CO92
Repliconchromosome [GenBank: NC_003143] [Browse all T6SS(s) in this replicon]
Location [Strand]3050889..3051674 [+]
ProductOmpA family protein
NoteTssL
UniProt IDQ0WDG8
KEGG IDype:YPO2723
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 6.30E-18, Aligned region: 2..94
OmpA [PF00691], Evalue: 1.40E-16, Aligned region: 155..253
Protein Sequence: 261 a.a.     [Download]
>gi|218929795|ref|YP_002347670.1| OmpA family protein, partial [Yersinia pestis CO92]
YADGLEVLLRILGLGFEGRYSIIEDGDRQLTKIRQGLLTLLQSTRDTIPPALSPHGLIAHQNRRRRGIFV
PVRVSMLLCGFLIVATFIGCKYFLSVPESDLLKRMGALQRVVVTPPVAAPKLRLSILLKDEIAKQLVSVD
ETSNNSKVIFKGDSMFMVGSDNVRPEMIDVIKRVAQEVHRVKGAILIVGHTDSMPINKPGFPNNQVLSEK
RAANVARYMEQAGIPTDKIRFEGKGETQPVSSNDDATGRSQNRRVEIFVNY
 
Nucleotide Sequence: 786 bp     [Download]
>gi|16120353|ref|NC_003143.1|:3050889-3051674 Yersinia pestis CO92 chromosome, complete genome
TATGCGGATGGTTTAGAGGTTTTGCTGCGCATTTTAGGGCTCGGTTTTGAGGGGCGCTACAGCATTATCG
AAGATGGTGATCGGCAATTAACTAAAATACGCCAAGGGTTGCTGACGCTGCTCCAAAGTACCCGAGACAC
GATCCCACCGGCACTTTCTCCGCATGGGTTGATCGCACATCAAAACAGAAGACGGCGGGGCATTTTTGTT
CCGGTGCGCGTATCCATGCTGTTGTGTGGTTTCCTCATTGTCGCGACCTTTATTGGATGTAAATACTTTC
TCTCGGTACCGGAAAGTGACTTGCTAAAAAGAATGGGAGCATTGCAACGTGTGGTTGTGACGCCACCCGT
TGCCGCACCAAAACTTCGACTGTCTATTTTATTAAAAGATGAGATAGCGAAGCAGTTAGTCAGTGTTGAT
GAAACGAGCAACAACAGCAAAGTCATCTTTAAAGGCGACTCTATGTTTATGGTCGGCTCGGATAACGTCA
GACCTGAAATGATTGACGTAATTAAACGCGTCGCGCAGGAAGTGCATCGCGTTAAAGGGGCAATCCTCAT
CGTCGGGCATACAGACTCTATGCCGATTAATAAACCCGGCTTCCCTAATAACCAGGTACTTTCCGAAAAA
CGCGCGGCCAATGTTGCACGCTATATGGAGCAGGCCGGTATTCCAACCGACAAAATTCGGTTTGAGGGCA
AGGGGGAAACGCAACCGGTTAGCAGCAATGACGATGCGACAGGACGTTCGCAAAACCGCCGCGTAGAAAT
TTTTGTTAATTATTGA
 Primer design