SecReT6
Protein ID: 218929797
SecReT6 ID20
T6SS typeN/A
Gene symbol-
Locus tagYPO2725
StrainYersinia pestis CO92
Repliconchromosome [GenBank: NC_003143] [Browse all T6SS(s) in this replicon]
Location [Strand]3055804..3058569 [+]
Producthypothetical protein
NoteTssI
UniProt IDQ0WDG6
KEGG IDype:YPO2725
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 7.80E-76, Aligned region: 29..347
Phage_base_V [PF04717], Evalue: 4.10E-24, Aligned region: 387..480
Protein Sequence: 921 a.a.     [Download]
>gi|218929797|ref|YP_002347672.1| hypothetical protein YPO2725 [Yersinia pestis CO92]
MSRTINLSSPAMPYLLGEPALVLSKLEGEEAFSTLYSYTITAKTPANPLIPWQAASNVDLKSLIGKEMTI
EMELDGNGLGDVRSVGKGTREITGLVERARYIGRDANQAIFEITIKPWFYLANLTSDFKIYQNKNVVDII
EEVFSDYNFPFEKRLATTYPILDFQVQYGETDFNFLQRLMEEWGIYWFFEHQDHKQKLILVDHVGAHKRS
FSTAYHAIEYLSDEPKAGEEYITQFQTQETLTSGTWVTNDYDFTKSRADILAMDSKPRKTSFNDLEIYHW
PGDYDQPDIGEHLSRVRIEERGALGSRAVGSGQLRGIVCGANFELKGFPVDKANREYMIISSRLTVAEVD
QLSGGEDAFSCESSFTVQPTTKIYRHPQVTPKPKTNGPQNAIIVGPPGEEIWTDEYGRVKVRFVWDRYGT
NSESDSCWLRVSQAWAGNSFGGIYIPRIGQEVIVDCINGDPDRPMVMGSLYNNVTRPPWDLPANATQSGM
VSRTVGGGLTNYNGVRFEDKSGLEQYWEQAERDMSRLTKNNETQIIGADSVLNVGANRSEVVGANYNQDV
LGTSMLAIGAASMLQVGLARSVVVGGAHSLNVVLANATNVGGANMTNVGGFNGLAVGGAHQTAVGGAATL
AAGGPIAIGAGGELILSGDIVKIVGKSKVIIQGGEVHINSDDCCGRKTGNGGGAFGAFASLAGLLPLAGA
IALPLPLPLLPIVVPPVTSPPDPTVPPDPTLPPDPTLPPDPTLPPETTAPPETTAPPETTAPPETTAPPE
TTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAP
PETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPEPT
RTPPGTQTPPP
 
Nucleotide Sequence: 2766 bp     [Download]
>gi|16120353|ref|NC_003143.1|:3055804-3058569 Yersinia pestis CO92 chromosome, complete genome
ATGTCAAGGACAATAAATTTGAGCAGCCCGGCTATGCCTTATCTATTGGGTGAGCCTGCGCTGGTACTGT
CTAAGTTGGAAGGCGAGGAAGCCTTTTCGACTTTATATTCTTATACTATTACGGCAAAGACACCGGCTAA
CCCATTAATTCCTTGGCAAGCGGCTTCAAATGTCGATCTCAAATCCTTAATTGGTAAAGAGATGACGATT
GAAATGGAACTGGACGGCAACGGCCTGGGTGATGTGAGAAGTGTAGGTAAAGGCACGCGTGAAATTACGG
GGCTGGTTGAGAGAGCCAGATACATTGGTCGAGATGCCAATCAGGCCATATTTGAGATCACTATTAAGCC
TTGGTTCTACCTGGCTAATTTAACCTCTGACTTTAAAATTTATCAAAATAAAAATGTCGTTGATATTATA
GAGGAAGTGTTCTCAGACTATAATTTTCCGTTTGAGAAACGGTTGGCTACAACCTATCCGATATTAGATT
TTCAGGTTCAGTACGGTGAAACCGACTTTAATTTCCTTCAGCGTTTGATGGAAGAGTGGGGTATTTACTG
GTTCTTTGAGCATCAGGATCATAAACAAAAATTAATTCTTGTGGATCATGTCGGTGCGCATAAACGCTCG
TTCAGTACCGCCTACCATGCCATTGAGTACTTGTCGGATGAGCCTAAAGCGGGCGAAGAGTACATCACAC
AATTCCAGACTCAGGAAACCTTGACGAGTGGGACCTGGGTCACCAACGATTATGACTTCACGAAATCCCG
TGCCGATATTCTGGCAATGGACAGTAAACCGCGTAAAACCAGCTTTAACGATCTCGAGATTTATCACTGG
CCAGGGGATTATGATCAGCCAGATATTGGTGAGCACCTTTCACGCGTGCGTATCGAAGAACGTGGTGCTC
TGGGTTCGCGGGCGGTCGGTTCTGGTCAACTGCGCGGGATAGTTTGTGGTGCTAACTTCGAGCTGAAAGG
GTTCCCCGTTGATAAAGCGAATCGGGAATACATGATTATCTCCAGCCGTTTGACGGTGGCTGAAGTTGAT
CAACTGTCTGGCGGTGAGGATGCGTTTAGTTGCGAGAGTTCTTTCACGGTTCAGCCGACGACCAAAATCT
ATCGTCACCCACAGGTGACACCAAAACCGAAAACCAATGGGCCGCAAAACGCCATTATTGTGGGGCCACC
GGGTGAAGAGATTTGGACCGATGAATATGGCCGCGTAAAAGTGCGTTTCGTTTGGGATCGCTATGGCACA
AACAGCGAGTCAGACTCTTGCTGGCTACGTGTTAGCCAGGCTTGGGCAGGGAACAGCTTTGGTGGGATCT
ATATTCCACGCATTGGTCAGGAAGTCATTGTTGACTGTATTAACGGCGATCCTGACCGGCCAATGGTGAT
GGGCAGCCTTTATAATAACGTGACGCGTCCCCCTTGGGACCTGCCTGCCAATGCGACGCAAAGTGGCATG
GTCAGTCGTACCGTTGGCGGCGGGTTAACCAACTATAACGGCGTTCGTTTTGAAGATAAATCGGGGCTGG
AGCAGTACTGGGAACAGGCCGAGCGCGATATGTCGCGTTTGACTAAAAATAATGAAACGCAAATTATCGG
TGCCGATTCTGTCCTGAATGTAGGGGCCAACCGAAGTGAAGTTGTCGGGGCCAATTATAACCAAGATGTT
CTTGGCACATCAATGTTAGCCATCGGTGCAGCCTCTATGCTACAGGTGGGATTGGCGCGTAGCGTTGTGG
TTGGCGGAGCACATTCACTGAATGTGGTTTTGGCGAATGCCACCAATGTGGGTGGCGCTAACATGACCAA
CGTAGGGGGGTTTAATGGCCTTGCGGTGGGGGGAGCCCATCAGACAGCTGTAGGCGGTGCTGCGACACTG
GCTGCCGGCGGCCCTATTGCTATTGGGGCGGGTGGTGAGCTTATCCTCAGTGGGGATATCGTAAAAATTG
TTGGTAAAAGTAAGGTTATTATTCAGGGCGGTGAAGTTCACATTAACTCTGATGATTGTTGTGGTCGTAA
AACGGGCAATGGCGGCGGGGCATTCGGTGCCTTTGCGAGCCTGGCAGGTTTATTGCCGCTGGCGGGTGCT
ATTGCCTTACCGCTACCGTTACCCTTGTTGCCAATAGTGGTGCCACCAGTGACATCGCCACCGGATCCAA
CAGTGCCACCGGATCCGACATTGCCACCAGATCCAACGTTGCCACCAGATCCAACGTTACCGCCGGAAAC
CACGGCACCGCCGGAAACCACGGCACCGCCAGAAACAACGGCACCGCCAGAGACAACGGCACCGCCGGAA
ACCACGGCACCGCCGGAAACAACGGCACCGCCAGAGACAACGGCACCGCCAGAGACAACGGCACCGCCAG
AAACAACGGCACCGCCGGAAACAACGGCACCGCCGGAAACAACGGCACCGCCGGAAACAACGGCACCGCC
GGAAACCACGGCACCGCCAGAGACAACGGCACCGCCAGAGACAACGGCACCGCCGGAAACAACGGCACCG
CCAGAAACAACGGCACCGCCGGAAACAACGGCACCGCCGGAAACAACGGCACCGCCGGAAACAACGGCAC
CGCCGGAAACAACGGCACCGCCAGAAACAACGGCACCGCCGGAAACAACGGCACCGCCAGAAACAACGGC
ACCGCCGGAAACAACGGCACCGCCAGAAACAACGGCACCGCCAGAAACAACGGCACCGCCGGAACCGACG
CGAACACCGCCAGGGACGCAGACGCCACCGCCTTGA
 Primer design