SecReT6
Protein ID: 220922990
SecReT6 ID327
T6SS typei3
Gene symbol-
Locus tagMnod_3048
StrainMethylobacterium nodulans ORS 2060
Repliconchromosome [GenBank: NC_011894] [Browse all T6SS(s) in this replicon]
Location [Strand]3142807..3146421 [+]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDB8IIC0
KEGG IDmno:Mnod_3048
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 5.00E-88, Aligned region: 184..443
IcmF-related [PF06761], Evalue: 1.30E-73, Aligned region: 496..809
IcmF-related [PF06761], Evalue: 1.30E-73, Aligned region: 935..961
DUF1215 [PF06744], Evalue: 2.80E-32, Aligned region: 942..1065
Protein Sequence: 1204 a.a.     [Download]
>gi|220922990|ref|YP_002498292.1| type VI secretion protein IcmF [Methylobacterium nodulans ORS 2060]
MITLPRSRPLWLGLLATLAGSAALAALVWWAGPLVAFGTARPLEGDLPRAALAAAILLAGLATCGLRLRR
HRRSVAALEAEISRDEGDGAVLGATMRDALATLRKVGSPKGDPLYELPWYVIIGPPGAGKTTALVNSGLK
FPLAREGAAAAVAGAGGTRYCDWWFAEEAVLIDTAGRYTTQDSDPRGDRESWLAFLDLLKRHRPRQPING
VLVAISLEDLIAGPPEAVAAHASAVRKRLLELHERLGVDFPVYALFTKADLIAGFAEFFGHLPEAGRRMV
WGHTFQTGERTRNMVGSVAAEFDALVERTNAWLPDRLQEEPNPTSRVVLFGFPSQVASLKDLVVDFLTAV
FEPTRYHAAAALRGFYFVSGTQQGTPIDRLIGALSRSFGSQDAAPDAAPGLGRSFFLADLLRKVVIAEAG
WVSTNRAALRRLLALRAGAYAGLALAAALAVGLWWTSFLRNEALSGQAAAGAAKYRAEAVDVLRDSVVAD
RNFSKVLPYLNTLRYLPAGYASRGEAGPVLATFGLSQRARLGSAAETAYHAGLERLLRPRLIYRLEELIE
ANRGNPGVLYEALKVYLMIGRRPEAPLDRDLVLAWMRRDWAEFLYSGAGFAKGRQLLEDHLVAMLDLEDA
GEPVVSINQGLVEETQRTLARLSVAERAYELLKSEARASGRRDWTLAAAAGPDAALVFEATGRGDLDGVR
VPYFLTYDGFFDAFIDRFGDIAEAVGRDRWVLGGAGEEEAYTAQYGSLFADLLKLYARDFAAAWRSTLGR
LKLRPLAADRPRYVALTALAAPTSPLKRLLESVGAETRLTRERPAARPGTEADPRATKAAAVVAGALSAE
AERQAAGVLPSRVASTASALGRLALERTPPQAAGPARIDASEAPGAAIEAGFRAFHAVLDGEGGKRAVDA
LLANLSDLRAAALEAAAPGGATAPLSAQARNLRSLASRFPAPFEAMIQGAAAEFEGSVTGAAVAGLAQGL
AETVTRECQAAVAGRYPFARSEREIPLADFARLFAPGGILDRFFTQNLVSHVDRSRPQWTWRADDQVARA
FSLATLREFQRAAEIRDAFFAAGGTTPGFTLAVTPLALTGDATRAKFELNGSTVEAGTGVNAPASLAWPG
ASGLGRAAVSVEGIFGTNAASVERAGAWALYRLLEAGSLLRQGDAVVATFSLGGRDVSYRLAVSAIANPL
TLPALREFRCPSSL
 
Nucleotide Sequence: 3615 bp     [Download]
>gi|220920054|ref|NC_011894.1|:3142807-3146421 Methylobacterium nodulans ORS 2060 chromosome, complete genome
ATGATCACACTGCCCCGCTCCCGCCCTCTCTGGCTCGGTCTTCTCGCCACGCTCGCAGGCTCCGCCGCCC
TCGCGGCGCTCGTCTGGTGGGCCGGTCCTCTCGTGGCCTTCGGCACAGCGCGTCCGCTCGAAGGCGACCT
CCCGCGCGCCGCGCTCGCCGCCGCGATCCTGCTCGCGGGGCTCGCCACCTGCGGGCTTCGCCTGCGGCGC
CACAGGCGGAGCGTAGCGGCGCTCGAAGCCGAGATCAGCCGGGACGAGGGCGACGGCGCGGTCCTCGGCG
CGACCATGCGCGACGCGCTCGCGACGCTGCGCAAGGTCGGCTCGCCCAAGGGCGACCCGCTCTACGAACT
GCCCTGGTACGTCATCATCGGCCCGCCGGGCGCCGGCAAGACGACGGCGCTGGTCAATTCCGGGCTCAAG
TTCCCGCTCGCGCGCGAGGGCGCCGCCGCCGCGGTGGCCGGCGCGGGCGGCACGCGCTACTGCGACTGGT
GGTTCGCCGAGGAGGCCGTGCTGATCGACACGGCCGGCCGCTACACCACGCAGGATTCCGATCCCCGCGG
CGACCGCGAGAGCTGGCTCGCCTTCCTCGACCTCCTCAAGCGCCACCGGCCGCGCCAGCCCATCAACGGC
GTCCTCGTCGCCATCAGCCTGGAGGACCTGATCGCCGGGCCGCCCGAGGCGGTCGCCGCCCACGCCTCCG
CCGTCCGCAAGCGGCTCCTCGAACTGCACGAGCGGCTCGGCGTCGACTTCCCGGTCTACGCCCTGTTCAC
CAAGGCCGACCTCATCGCGGGCTTCGCCGAATTCTTCGGCCATCTGCCGGAGGCCGGGCGGCGCATGGTC
TGGGGCCATACCTTCCAGACCGGTGAGCGCACCCGCAACATGGTCGGGTCGGTCGCCGCCGAGTTCGACG
CCCTCGTCGAGCGGACGAACGCGTGGCTGCCCGACCGGCTGCAGGAGGAGCCGAACCCGACCTCGCGGGT
CGTGCTCTTCGGCTTCCCGTCCCAGGTCGCCTCGCTCAAGGACCTCGTCGTCGACTTCCTCACCGCCGTC
TTCGAGCCGACGCGCTACCACGCGGCGGCGGCCCTGCGCGGCTTCTACTTCGTGTCGGGCACGCAGCAGG
GCACGCCGATCGACCGGCTCATCGGCGCCCTGTCGCGCAGCTTCGGCTCGCAGGACGCGGCGCCCGATGC
CGCCCCGGGGCTCGGGCGCAGCTTCTTCCTCGCCGACCTCCTGCGGAAGGTCGTCATCGCCGAGGCCGGC
TGGGTCTCGACGAACCGGGCCGCGTTGCGCCGCCTGCTGGCCCTGCGCGCGGGTGCCTATGCGGGCCTCG
CGCTCGCGGCGGCGCTCGCGGTAGGCTTGTGGTGGACGAGCTTCCTGCGCAACGAGGCGCTCTCGGGCCA
AGCCGCCGCAGGGGCCGCGAAGTACCGCGCCGAGGCGGTCGACGTCCTGCGCGACTCCGTCGTCGCCGAC
CGCAACTTCTCGAAGGTCCTGCCCTATCTCAACACCCTGCGCTACCTGCCGGCCGGCTACGCGAGCCGCG
GCGAGGCCGGGCCGGTCCTGGCGACCTTCGGGCTCTCCCAGCGCGCGCGGCTCGGCTCGGCGGCGGAGAC
CGCCTACCATGCCGGCCTCGAACGCCTGCTGCGCCCGCGCCTGATCTACCGGCTCGAAGAGCTGATCGAG
GCCAATCGCGGCAATCCGGGCGTCCTCTACGAAGCCCTGAAGGTCTACCTGATGATCGGGCGCCGGCCCG
AGGCACCCCTCGACCGCGACCTCGTCCTCGCCTGGATGCGCCGCGACTGGGCGGAGTTCCTCTACTCCGG
CGCGGGCTTCGCCAAGGGCCGCCAGCTGCTGGAGGACCACCTCGTGGCGATGCTCGACCTGGAGGATGCG
GGCGAGCCCGTCGTGTCGATCAACCAGGGGCTCGTCGAGGAGACGCAGCGCACCCTCGCGCGGCTGAGCG
TCGCCGAGCGCGCCTACGAACTCCTCAAGTCGGAGGCGCGCGCCTCGGGCCGCCGCGACTGGACGCTCGC
CGCCGCCGCAGGACCCGACGCCGCCCTCGTCTTCGAGGCGACCGGGCGGGGCGACCTCGACGGCGTGCGC
GTGCCCTATTTCCTGACCTACGACGGCTTCTTCGACGCCTTCATCGACCGATTCGGCGACATCGCCGAGG
CGGTGGGGCGCGACCGCTGGGTGCTCGGCGGCGCGGGCGAGGAGGAGGCCTACACGGCGCAGTACGGCTC
GCTCTTCGCCGACCTCCTCAAGCTCTACGCCCGCGACTTCGCGGCGGCGTGGCGCAGCACTCTCGGGCGC
CTGAAGCTGCGCCCGCTTGCCGCCGACCGGCCGCGCTACGTGGCGCTCACCGCGCTCGCGGCTCCGACCT
CTCCGCTCAAGCGCCTCCTCGAATCCGTCGGAGCCGAGACGCGCCTGACCCGCGAGCGGCCCGCGGCCCG
GCCCGGGACGGAGGCCGATCCCCGCGCCACGAAGGCCGCTGCCGTCGTGGCCGGCGCGCTGTCGGCGGAA
GCCGAGCGGCAGGCCGCGGGCGTGCTGCCGTCCCGCGTGGCCTCGACCGCCTCAGCGCTCGGGCGCCTCG
CGCTCGAACGCACGCCGCCCCAGGCCGCAGGCCCGGCGCGGATCGACGCGAGCGAGGCGCCGGGCGCCGC
GATCGAGGCGGGCTTCCGGGCCTTCCACGCCGTGCTCGACGGCGAGGGCGGGAAGCGGGCGGTCGACGCC
CTGCTGGCGAACTTGAGCGACCTGCGCGCCGCCGCGCTGGAGGCCGCCGCGCCGGGCGGGGCGACCGCGC
CGCTCTCCGCCCAGGCGCGCAACCTGCGCTCGCTCGCGTCCCGCTTCCCGGCCCCGTTCGAGGCCATGAT
CCAGGGGGCCGCAGCCGAGTTCGAGGGCAGCGTCACGGGGGCGGCGGTGGCGGGCCTCGCCCAGGGGCTG
GCCGAGACCGTCACGCGGGAGTGCCAGGCGGCCGTCGCGGGCCGCTACCCCTTCGCGCGCTCCGAGCGGG
AGATCCCGCTCGCCGACTTCGCCCGGCTCTTCGCCCCCGGCGGCATCCTCGACCGCTTCTTCACGCAGAA
CCTCGTCTCCCACGTGGACCGCTCGCGGCCGCAATGGACGTGGCGCGCCGACGACCAGGTCGCCCGCGCC
TTCTCGCTCGCGACCCTTCGCGAGTTCCAGCGCGCGGCCGAGATCCGCGACGCCTTCTTCGCGGCCGGCG
GGACCACGCCCGGCTTCACCCTCGCGGTCACGCCGCTCGCGCTGACCGGGGACGCGACGCGCGCGAAGTT
CGAGCTGAACGGCAGCACCGTCGAGGCGGGCACCGGCGTGAACGCGCCCGCCTCGCTCGCCTGGCCCGGC
GCCTCCGGCCTCGGCCGCGCGGCGGTGAGCGTCGAGGGGATCTTCGGGACGAACGCGGCCAGCGTCGAGC
GCGCGGGGGCCTGGGCCCTCTACCGCCTCCTGGAGGCCGGCTCGTTGCTCCGGCAGGGCGACGCGGTCGT
GGCGACCTTCTCGCTCGGAGGACGCGACGTATCCTACCGCCTTGCCGTGAGCGCCATTGCCAATCCGCTC
ACGCTTCCGGCGCTGCGGGAGTTCCGCTGCCCGAGCAGCCTGTGA
 Primer design