SecReT6
Protein ID: 22125448
SecReT6 ID31
T6SS typei3
Gene symbol-
Locus tagy1553
StrainYersinia pestis KIM10+
Repliconchromosome [GenBank: NC_004088] [Browse all T6SS(s) in this replicon]
Location [Strand]1720666..1724244 [+]
Producthypothetical protein
NoteTssM
UniProt IDQ8CLD8
KEGG IDypk:y1553, ypm:YP_2442
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 4.00E-84, Aligned region: 501..816
ImcF-related_N [PF14331], Evalue: 4.30E-72, Aligned region: 168..453
DUF1215 [PF06744], Evalue: 9.10E-30, Aligned region: 543..564
DUF1215 [PF06744], Evalue: 9.10E-30, Aligned region: 931..1044
Protein Sequence: 1192 a.a.     [Download]
>gi|22125448|ref|NP_668871.1| hypothetical protein y1553 [Yersinia pestis KIM10+]
MIGPFILVGDDHPLTDGIRRGIIIAIIAFITLIYGTWCLVKALAKNPALLDNFIKHKKAAKPEAEAELSE
VNAMIRNGMNYVRRIHSGIPAWRRFFISNRWRTELPWFMVVGMKGAGKTALILSSGQDFPLPEQLNRIGK
ENPPTQHCECLFSNDALFLDTSGKYIDDSKDNQTEWTGILKALKKYRPVKAINGVIVAISASDILGKSKA
DLLNVSATLRTRLDEVRAVLGVRFPVYVTITKLDQISGFDEYFRNLTAEDREQIWGVTFPYNEAKEQSDM
PLQQRISHELALLEDRISNNMHVRQQEEYAVADRKGMYALPQDFRMLSQRVTEVLQNVFFASRFDETKFH
TTLRGIYFVSSCQPADVELLNNNTLIQKWRNVINHKKPLSPADLSQKSDNEDRFISDVAYGKQYFLKQLF
SDVITKDADLVSYNLKVQSKYRFQNLLGHAACIGLAVWLVWAFLVSFQHNEGYLQATGAKLSQLESTVMS
YAKTSNEQILPALLNATQQLPEYGTLDVANPELDWRYGLYTGSAISQGANTLYQFFLQKYLFPMVENQSE
VTLRKTMHSGQSEEVYAALKLYLMLTGEGKFDRQYMIEHVTQDWQKSGKIEPYEEKSIFVGHLNTLFTLK
DWRQYGQPADSELIKQARAILAEKTVTARLWGRIQSRLLADAPANMTLRKMVGEHATQVFTLSDDELLHE
GIPGLYTYAGYHEVVKKKLTPLLMLLQEEDRWVMAQSLSSSLDPLTLRQDVLVMYLQGYAAYWKRFLSSV
RLISVDADSAEYAQGLSLDIALLRTLVSENSPLLNLARQAVKETTLAEKEKAITDEINIRTQGQLLSQAK
KLQETIAFRENKLIKEWVDNRFESLRVFVNGEQSADVTGGNNLSVLQGTQMSRIIGTLNDQYTRFVVYNS
AFEYGDIPPLSQDGERIAVESQTWPDPFRNIIAPLLTGSSQKFENKVITHTSKAIDMGVGEICRNTLQGR
YPFAESEQIVSLNDFERFFGTDGTVDSYFKKNLESKVDTSSIPWRYKGSVSSEGLAFFEQAAMIRNVLFN
TNDGKKMALDFSVSVRYLAPTITQLIMNFDGNTVRYSHGPVTPAFFKWPGLRQGTIVSLTAQRQKASAMP
DILFRGPWALLQWADQADEIRDEANGKQTLTYLMGKDRVELEVSGLTHGGETISDLLRDFKCPSVNDMNG
IW
 
Nucleotide Sequence: 3579 bp     [Download]
>gi|22123922|ref|NC_004088.1|:1720666-1724244 Yersinia pestis KIM 10 chromosome, complete genome
GTGATTGGCCCATTCATATTAGTTGGTGATGATCATCCTCTGACTGATGGGATCCGTCGCGGCATCATTA
TCGCCATCATTGCATTTATTACACTTATTTATGGCACCTGGTGCTTAGTCAAAGCATTGGCGAAAAATCC
AGCGTTACTGGATAACTTCATTAAGCACAAGAAAGCGGCCAAGCCTGAAGCGGAGGCTGAACTTTCTGAA
GTTAATGCGATGATCCGCAATGGCATGAACTATGTGCGCCGTATTCACAGTGGTATTCCGGCCTGGCGAC
GTTTCTTTATCTCCAACCGTTGGCGCACAGAACTGCCTTGGTTCATGGTTGTCGGTATGAAAGGTGCAGG
GAAAACCGCCCTTATCCTCTCTTCAGGACAGGACTTTCCTTTACCTGAGCAGCTGAATCGTATTGGCAAA
GAAAACCCACCCACTCAACATTGTGAATGTTTGTTCTCTAATGACGCCCTGTTTTTAGACACTTCAGGGA
AATACATTGATGACAGCAAAGATAATCAGACTGAGTGGACCGGGATATTAAAGGCACTCAAAAAATATCG
TCCGGTTAAGGCAATTAATGGTGTCATTGTTGCGATTTCGGCATCCGATATCTTGGGTAAAAGTAAAGCT
GATTTACTGAATGTGTCGGCGACGCTACGCACGCGTTTGGATGAGGTTCGTGCGGTCTTGGGCGTCCGTT
TCCCGGTGTATGTCACGATTACAAAACTGGATCAAATATCGGGTTTTGATGAATATTTCCGTAATTTAAC
GGCTGAAGATCGCGAGCAAATTTGGGGGGTGACTTTCCCTTATAACGAGGCGAAAGAGCAATCCGATATG
CCACTTCAGCAACGTATCAGCCATGAGCTGGCACTGCTTGAGGATCGTATCAGCAATAATATGCACGTCC
GCCAGCAGGAAGAGTATGCCGTGGCGGACAGAAAAGGCATGTATGCACTCCCTCAGGATTTCAGGATGCT
CTCCCAGAGGGTAACGGAAGTTTTACAGAATGTTTTCTTCGCCTCACGCTTTGACGAAACAAAATTTCAC
ACGACCCTGAGAGGGATCTATTTTGTCAGCAGTTGTCAGCCTGCGGATGTTGAACTGTTAAATAACAACA
CGCTGATTCAAAAGTGGCGTAACGTTATTAATCATAAAAAACCGTTATCGCCAGCCGATTTATCACAAAA
AAGTGATAATGAAGATCGGTTTATTAGCGATGTGGCTTACGGGAAACAATATTTCCTCAAGCAGTTGTTT
AGCGATGTGATTACCAAAGATGCCGACTTAGTCAGCTATAACCTGAAAGTACAATCCAAATACCGTTTTC
AGAATCTATTGGGACACGCGGCTTGTATTGGGTTGGCAGTTTGGCTGGTTTGGGCCTTCTTGGTCAGCTT
CCAGCATAACGAGGGGTATTTACAGGCGACCGGTGCCAAGCTGAGTCAGTTAGAAAGCACGGTGATGAGT
TATGCCAAAACGTCCAATGAGCAGATCTTACCTGCGTTATTGAACGCGACACAGCAGTTACCCGAGTACG
GTACGCTGGATGTGGCTAACCCTGAGCTTGACTGGCGTTATGGCTTATATACCGGTAGCGCAATCTCACA
AGGTGCGAACACGCTCTATCAGTTTTTCTTGCAAAAATATCTCTTCCCAATGGTTGAGAATCAGAGTGAG
GTTACATTAAGAAAAACGATGCACTCAGGTCAGAGCGAAGAGGTTTATGCCGCGCTGAAGCTTTATTTGA
TGCTGACGGGTGAAGGTAAATTTGATCGTCAATATATGATTGAGCACGTGACCCAAGATTGGCAGAAAAG
TGGAAAAATTGAGCCTTACGAAGAGAAGAGTATTTTCGTCGGTCATTTGAACACGCTGTTTACCCTGAAA
GACTGGCGGCAGTATGGGCAACCGGCAGACAGTGAACTGATTAAGCAGGCTCGGGCAATACTGGCGGAAA
AAACAGTGACCGCCAGACTTTGGGGGCGTATTCAATCCCGCTTATTGGCCGATGCCCCTGCCAATATGAC
GTTACGTAAAATGGTGGGTGAGCACGCGACACAGGTATTCACCCTGTCAGATGATGAACTACTGCATGAA
GGGATCCCGGGGCTTTATACCTACGCGGGCTACCATGAGGTGGTTAAAAAAAAACTGACACCTTTGCTGA
TGTTACTTCAGGAAGAGGATAGGTGGGTGATGGCGCAATCGCTGTCATCTTCTCTTGACCCCCTGACGTT
AAGACAAGATGTTCTGGTGATGTATTTACAAGGGTATGCCGCTTATTGGAAACGCTTTCTCTCCAGTGTT
CGTCTGATTTCTGTCGATGCGGACAGTGCAGAGTATGCTCAAGGGCTGTCTCTGGATATTGCTTTGTTAA
GGACGTTAGTTTCAGAAAATTCACCGCTACTCAATTTAGCCAGGCAGGCGGTAAAAGAAACGACACTCGC
CGAAAAAGAAAAAGCCATTACTGATGAGATAAACATCAGAACGCAAGGGCAATTACTCAGCCAGGCTAAA
AAATTACAAGAAACGATCGCGTTTCGTGAAAATAAACTGATTAAAGAGTGGGTTGATAATCGTTTTGAAT
CCCTGAGAGTCTTTGTTAATGGGGAACAGAGTGCTGATGTCACGGGGGGCAATAATCTTTCTGTTCTTCA
GGGAACGCAGATGAGCCGAATAATCGGGACATTAAACGATCAATATACCCGTTTTGTTGTTTATAACAGT
GCCTTTGAATATGGCGATATTCCTCCGTTATCCCAGGATGGGGAACGTATTGCGGTGGAATCACAAACAT
GGCCGGATCCGTTTAGAAATATTATTGCACCGTTATTAACGGGCTCATCCCAGAAATTTGAAAATAAAGT
GATTACTCACACGTCCAAAGCGATTGATATGGGGGTGGGGGAAATTTGCCGGAATACGCTGCAAGGGCGT
TACCCATTTGCTGAAAGTGAGCAAATTGTTAGTTTGAATGATTTTGAGCGTTTCTTCGGTACTGACGGTA
CGGTGGACAGTTATTTCAAGAAAAACTTGGAGAGTAAAGTCGACACGTCCTCAATACCTTGGCGTTATAA
GGGCAGCGTAAGTAGTGAAGGTTTGGCGTTCTTTGAACAGGCGGCAATGATCAGAAACGTGCTATTTAAT
ACCAATGACGGTAAAAAAATGGCATTAGATTTTTCCGTATCAGTGCGTTATTTAGCACCCACTATCACCC
AACTTATTATGAACTTTGATGGTAATACTGTGCGTTATTCCCATGGTCCCGTAACGCCAGCCTTCTTTAA
ATGGCCGGGTTTACGTCAAGGCACCATTGTCAGTTTAACGGCCCAACGCCAGAAGGCATCCGCGATGCCC
GATATTCTTTTTCGCGGACCTTGGGCACTCTTGCAGTGGGCTGATCAGGCCGATGAAATTCGCGATGAAG
CGAATGGCAAACAGACGCTGACTTATCTCATGGGGAAAGATCGTGTCGAGCTTGAAGTCTCAGGTTTAAC
GCATGGTGGTGAAACCATTAGCGATCTGCTGAGAGATTTCAAATGCCCCAGTGTCAATGACATGAATGGT
ATTTGGTAA
 Primer design