SecReT6
Protein ID: 22127532
SecReT6 ID34
T6SS typei3
Gene symbol-
Locus tagy3658
StrainYersinia pestis KIM10+
Repliconchromosome [GenBank: NC_004088] [Browse all T6SS(s) in this replicon]
Location [Strand]4062287..4065781 [-]
Producthypothetical protein
NoteTssM
UniProt IDQ8CKD9
KEGG IDypk:y3658, ypm:YP_3664
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 8.00E-75, Aligned region: 498..796
DUF1215 [PF06744], Evalue: 5.20E-30, Aligned region: 905..1024
ImcF-related_N [PF14331], Evalue: 3.60E-29, Aligned region: 95..114
ImcF-related_N [PF14331], Evalue: 3.60E-29, Aligned region: 194..375
Protein Sequence: 1164 a.a.     [Download]
>gi|22127532|ref|NP_670955.1| hypothetical protein y3658 [Yersinia pestis KIM10+]
MIRRMLILIIALVLCYIVWWIGPLIAIGPYFPLGGVWVRKIIIALILFWALWPFVAIFFSWIFRYARAPL
PKRKKKTVQLDRVSARFHDAMLTLQHADLSSQKTRWQRWRQRRKRQYIDAKPWFLVMGPPGCGKTSIVYE
SSEKFLLSEQYGLAQTTDIGPTQDCNWWLTDRAVYIDTAGEWILLHGQSEEAGTARQKLFSMIRKYRRYP
GVDGIVLCLDVSVLLNSSVTERKSLADTLRLRILEVASTFQADIAVYLFLNNIDKLPGGETFLSLMNDEL
LAGGLGISMTHNEKGQNNFVADEERYRELLTRVSRYVLEILHDSPNMEMRHQLLLFTESLGALQKPLFGL
FEQIFPATPIGYTGCLRQFWFGSTQNLTSWEALYYPSSTSTFESRPAGQMYFPALSQAITERGVLHATGP
MPLRNRLLNIGKYVFVVLVLCILLLMLSARYFWEYDYIGYATARFEETRRIVRDIPITNQVNDNLVAAYE
QLGYINTHYLESSPPLLTPYFEHRLLNQAMLQTYHRHLNKVFWPAVQNYVTNELKKDTQSPDGDNYDTLK
VYLMLGQPDHRSQEALVQWFMSRWESFAPQGYGQNDRKLFSYHLSELFSDTASAAPKVKLNDELIRESRI
KAMKTPIHIRVINRIHDAPLPARIEDLSLADAAGPSVTLMLRRKSPSTVTDLAIPAFYTRASYHDVVNPQ
LQEASEAMINEEAWVLSDGKASVSQVSLLAAAQKLSDEARKYYLMEYANQWDAFFNDIRVRPINGLDDAA
LLARQLSDPSSPLANLVRFSTREITLTTDNNGKGAMSSGWFNIQRNKLTTARRNIIDEMSGERSRFRLTP
EKAVEDRFELLRRLGYALQSASTSNSDPLGRTFEQIYNQLITLSTSLRAGQILPQNNDFSRLQIDMARQP
EPVRSIMMDLLAVGQTQSLQQSKANLSKGVSSIASDLCSNAVSGRYPFNRLASEEIGIGDFNRMFGRSGA
MQSFFDQNLAPYVDTNGNRWKVKPDSNGVVTPKTLRSFENSAQIRDTFFDASGKMAMSMIIRPISLTPSI
LEAVLDVDGQIINYSHGSNQPVKVDWPGPKGGVYIRLTFKTQDGNVETVSFNGPWAIFRMYDVSNPRPLG
VNSRELMMVMDNVSGVFKIELSSTMKDYPLWSKALAQFSCPKNL
 
Nucleotide Sequence: 3495 bp     [Download]
>gi|22123922|ref|NC_004088.1|:c4065781-4062287 Yersinia pestis KIM 10 chromosome, complete genome
ATGATACGCAGAATGTTGATTTTAATCATTGCCCTAGTGCTTTGTTATATTGTGTGGTGGATAGGGCCGC
TGATCGCCATTGGCCCCTATTTCCCTCTGGGGGGGGTATGGGTTCGTAAGATCATTATTGCTCTGATTTT
ATTTTGGGCACTGTGGCCATTTGTTGCAATTTTCTTCAGTTGGATTTTTCGTTATGCCCGTGCGCCACTT
CCCAAGCGCAAGAAAAAAACGGTTCAGCTTGATCGCGTTTCTGCACGTTTTCATGATGCGATGCTCACCC
TGCAACATGCGGATCTTTCAAGCCAGAAAACACGCTGGCAGCGCTGGCGTCAACGGCGTAAGCGCCAGTA
TATCGATGCTAAACCGTGGTTTCTGGTCATGGGGCCACCCGGATGCGGTAAAACGTCGATAGTTTATGAG
AGTAGCGAGAAGTTCCTACTCTCAGAACAGTATGGTTTAGCGCAGACCACGGATATTGGACCGACGCAGG
ACTGTAATTGGTGGCTGACGGATCGTGCTGTTTACATCGATACGGCAGGGGAATGGATCCTGCTGCATGG
TCAGAGCGAAGAAGCGGGCACGGCTCGGCAAAAATTGTTCTCTATGATCCGCAAATATCGCCGTTATCCG
GGGGTTGATGGGATTGTTCTTTGCCTTGACGTCAGCGTGCTTTTGAACTCTTCGGTGACGGAACGTAAGT
CACTGGCTGATACGTTGCGCCTGCGGATCCTGGAAGTTGCCTCGACATTTCAGGCCGATATTGCGGTGTA
CTTGTTCCTCAACAATATCGATAAGTTACCTGGCGGCGAAACCTTCCTCTCGTTAATGAACGACGAACTT
CTGGCCGGAGGGCTTGGGATTAGCATGACCCATAATGAAAAGGGGCAGAACAATTTCGTTGCCGATGAAG
AACGTTACCGTGAACTCCTGACACGTGTTAGCCGTTATGTGTTGGAAATACTGCACGATTCGCCCAACAT
GGAGATGCGCCACCAATTGCTGCTGTTTACAGAAAGCCTGGGAGCGCTACAAAAACCCCTGTTTGGCTTA
TTCGAACAAATATTTCCGGCGACACCGATTGGCTATACCGGTTGTTTGCGGCAGTTCTGGTTTGGCAGTA
CCCAAAATCTGACCTCATGGGAGGCGCTGTATTATCCGTCATCGACCAGCACCTTTGAAAGCCGGCCTGC
TGGGCAGATGTATTTCCCTGCACTGAGTCAAGCGATCACCGAAAGGGGGGTATTACACGCCACTGGCCCC
ATGCCTTTGCGAAATCGCCTGTTAAACATCGGTAAATATGTGTTCGTGGTCCTTGTGCTCTGCATCTTAT
TGTTGATGCTGAGCGCCCGCTATTTTTGGGAATATGACTATATTGGCTATGCGACAGCTCGGTTTGAGGA
AACCCGTCGGATTGTGCGTGACATCCCAATCACGAATCAGGTCAACGATAATCTGGTCGCAGCTTACGAA
CAGTTGGGGTATATCAACACCCATTATCTGGAAAGTTCACCGCCACTGCTGACACCGTACTTCGAGCACC
GTTTACTGAATCAGGCGATGTTGCAAACCTACCATCGTCACCTGAATAAAGTGTTCTGGCCTGCGGTACA
AAACTACGTCACCAACGAGCTGAAAAAGGACACTCAATCTCCTGACGGTGACAACTATGACACGCTGAAA
GTTTACCTGATGCTCGGACAACCTGATCACCGCTCTCAGGAGGCATTGGTGCAATGGTTTATGTCGCGCT
GGGAAAGTTTTGCGCCTCAGGGATATGGGCAAAACGACCGCAAACTCTTCAGTTATCATTTGAGTGAACT
GTTTTCTGACACCGCCTCAGCTGCCCCGAAAGTTAAGCTGAATGATGAGCTGATCCGTGAATCACGCATT
AAAGCGATGAAAACACCGATACACATCCGGGTGATTAATCGTATTCATGACGCCCCACTGCCCGCGAGGA
TTGAGGATCTTAGTCTGGCGGATGCCGCCGGTCCTAGCGTAACACTGATGCTGAGACGTAAAAGCCCCAG
TACAGTAACGGATTTGGCGATCCCGGCTTTCTACACTCGGGCCAGCTACCACGATGTGGTTAACCCACAA
CTTCAGGAAGCATCGGAAGCGATGATTAACGAGGAAGCGTGGGTGTTGAGTGACGGTAAAGCTTCGGTTA
GTCAGGTTAGTTTACTGGCTGCGGCGCAAAAACTGTCCGATGAAGCGCGCAAGTATTATCTGATGGAGTA
TGCCAACCAATGGGATGCATTCTTCAATGATATCAGGGTGCGCCCAATCAACGGACTTGATGATGCGGCG
CTGCTGGCAAGGCAACTCTCAGACCCGTCATCCCCGTTGGCTAATCTGGTGCGTTTCTCCACACGGGAAA
TAACCCTGACCACTGACAACAATGGTAAAGGGGCGATGTCGTCAGGCTGGTTCAATATTCAACGTAATAA
GCTCACGACTGCCCGCCGTAACATCATTGACGAAATGTCGGGTGAGCGTTCTCGTTTTCGTCTAACGCCA
GAGAAAGCGGTGGAGGATCGCTTTGAACTATTAAGACGTCTGGGATATGCCCTGCAAAGTGCGTCTACCA
GCAATTCTGATCCGTTGGGCCGAACCTTCGAGCAGATTTATAACCAGTTGATAACACTCTCGACTTCCCT
TCGGGCTGGGCAGATTTTGCCGCAAAATAACGATTTCAGTCGCTTGCAAATCGATATGGCCCGTCAGCCA
GAGCCGGTGCGCAGCATTATGATGGATCTGCTGGCCGTCGGACAAACGCAAAGTCTGCAACAAAGTAAGG
CCAACCTCAGCAAGGGCGTCTCTTCAATTGCTTCTGATTTATGTAGCAACGCCGTCAGTGGCCGTTATCC
CTTTAATCGGTTGGCTAGCGAAGAGATAGGTATTGGCGATTTCAACCGTATGTTTGGTCGTTCTGGGGCG
ATGCAAAGCTTCTTTGATCAGAATCTCGCACCGTATGTCGATACCAACGGCAACCGCTGGAAGGTAAAAC
CTGACAGTAACGGTGTGGTGACCCCTAAAACTCTGCGTTCGTTTGAAAACTCAGCACAAATCCGCGACAC
CTTCTTTGATGCCTCCGGCAAGATGGCGATGTCGATGATCATTCGCCCTATCTCACTGACTCCATCAATT
TTGGAAGCGGTTCTTGATGTCGATGGCCAGATTATTAACTACAGCCATGGTTCTAACCAACCGGTAAAAG
TTGATTGGCCAGGACCGAAAGGTGGGGTGTATATCCGCCTGACGTTCAAAACTCAGGATGGAAATGTGGA
AACCGTTAGCTTCAATGGTCCGTGGGCTATTTTCCGCATGTATGACGTTAGTAACCCTAGGCCACTCGGG
GTCAATAGCCGTGAACTCATGATGGTGATGGATAACGTGAGTGGCGTCTTCAAAATTGAGTTGAGTTCCA
CCATGAAAGATTATCCGCTGTGGTCAAAAGCATTGGCACAGTTCTCATGTCCTAAGAATCTCTAA
 Primer design