SecReT6
Protein ID: 221369489
SecReT6 ID328
T6SS typei3
Gene symbol-
Locus tagRSKD131_3652
StrainRhodobacter sphaeroides KD131
Repliconchromosome II [GenBank: NC_011958] [Browse all T6SS(s) in this replicon]
Location [Strand]575193..578714 [+]
ProductImcF domain protein precursor
NoteTssM
UniProt IDB9KTY4
KEGG IDrsk:RSKD131_3652
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 2.30E-87, Aligned region: 189..448
IcmF-related [PF06761], Evalue: 2.20E-68, Aligned region: 501..802
DUF1215 [PF06744], Evalue: 3.20E-32, Aligned region: 914..1032
AAA_16 [PF13191], Evalue: 0.00039, Aligned region: 127..259
AAA_16 [PF13191], Evalue: 0.00039, Aligned region: 461..461
AAA_16 [PF13191], Evalue: 0.00039, Aligned region: 784..812
Protein Sequence: 1173 a.a.     [Download]
>gi|221369489|ref|YP_002520585.1| ImcF domain protein precursor [Rhodobacter sphaeroides KD131]
MRLLRLLLAALTSRTLWTFLGLALLCGLIWQFGALVSVGETVPLASDLARGLVVGCIVVGWLLSLLAAQL
RAARRNQLFVTELAAPAPAAPDPGAAAVAEVGARFRQVMAEMKRSRVGGRRFLRDMPWYLLIGPPGTGKT
TALRQSGLHFPIDPGDDLQGVGGTRNCDWFFTEQAVLVDTAGRYVQQQSDPEADAAEWSGFLDLLKRHRG
RRALNGVIVALSMTELLGPEPALRAHGREIRKRLSELGQRLQIRLPVYLMVTKADLVPGFETFFAPLPAR
GREQVWGATLAPDERPEGGAVDREARALWQELEARVGPRLAEEATLADRAEIFRFPARMAEVEAPLRVLI
ATLFGESRYEDSPWLRGFYFTSATQEGSPIDRMLGELAGAFGLSAPAPPRRARGETRTYFLHDLLAKVIF
PEAGLGRLDRAAEERRRWLWRGSVAGAALATAVAGVGFLLSFLGWSGAIEDQARLTADLSARLANVAARQ
APTEPLDLPLALDAATAADAARTEPPSGPFALIGPSAAAEIERAGTIAYERTLANVLAPRMVALLEASMW
RQVRDPDDMLGALKAYFMLTGLAPYDRDFLTGWWQEELPQQAVLDPFPTEAARRHQLAALSLFGTQGDPI
PPDEELVAAALASICTIPLAARAYGALMQDPAVTGLPDWIPGDRAGPNGARIFTRLSGKTLRVGLPGAFT
FAGFQETILPLVPEVAAQATLDRTLFAGGCGGSAGASAATLEADILKLYSDDFIARWDGLLRDIRLAPLT
DFATATAAMKDLASPDSALKRLLAAVVAETDLTRVPASDAAPPEGLLNAASKKLGKVGKLVKGAASLTVG
SAPPAEPPGLAVARHFEPLKGMVAEVEGVPPRIGDAELALGALANALQTAAANPDPQAALTAQGGLATLT
GGLTEVAARLPPPIDAWLEGLATDAASVTREAAIDRLNARYRADILPFCRAATAGRYPFEPGSAIDVNTA
DFQRLFGPGGLFDGFTGDALGPWIDTTRHPWAWRADLGLDARSLAPFEAARRMRDGLFAGGIGPVMGFLL
QATDLSPNAARVTLSLDGQQLVYMNAATPPVGMTWPGQNGTNLIVLSFTPLDGSAEAVTSESGAWAWLRL
IGKGSLSPTAQPDLFRLRLAAGAYAARFDLRANSVENPLDLRLFGGFRCPDGF
 
Nucleotide Sequence: 3522 bp     [Download]
>gi|221368938|ref|NC_011958.1|:575193-578714 Rhodobacter sphaeroides KD131 chromosome 2, complete sequence
ATGCGCCTGCTCCGCCTCCTCCTCGCCGCCCTGACCTCGCGGACCCTCTGGACCTTCCTCGGGCTCGCGC
TCCTCTGCGGGCTGATCTGGCAGTTCGGCGCGCTGGTCTCGGTGGGCGAGACGGTGCCGCTCGCCTCCGA
CCTCGCGCGCGGGCTGGTCGTGGGCTGCATCGTGGTGGGCTGGCTTCTGTCGCTGCTGGCAGCCCAGCTG
CGGGCGGCGCGCAGGAACCAGCTCTTCGTGACCGAGCTTGCGGCGCCCGCCCCCGCCGCCCCCGATCCCG
GCGCGGCGGCCGTGGCCGAGGTCGGGGCGCGGTTCCGGCAGGTGATGGCCGAGATGAAACGCTCGCGCGT
GGGCGGGCGGCGCTTTCTGCGCGACATGCCGTGGTATCTGCTGATCGGCCCGCCCGGCACCGGCAAGACC
ACGGCCCTGCGCCAGTCGGGGCTGCATTTCCCGATCGATCCCGGCGACGACCTGCAAGGCGTGGGCGGCA
CGCGGAACTGCGACTGGTTCTTCACCGAACAGGCCGTGCTGGTGGACACCGCCGGGCGCTACGTCCAGCA
GCAGAGCGATCCCGAGGCCGATGCGGCGGAATGGTCGGGCTTTCTCGATCTGCTGAAGCGCCACCGCGGG
CGGCGGGCGCTGAATGGCGTGATCGTGGCCCTGTCGATGACCGAGCTTCTCGGGCCCGAGCCCGCGCTGC
GCGCTCATGGCCGCGAGATCCGCAAGCGGCTGAGCGAGCTCGGCCAGAGGCTCCAGATCCGCCTGCCGGT
CTATCTGATGGTGACGAAGGCCGACCTCGTGCCGGGCTTCGAGACCTTCTTCGCGCCCCTGCCCGCGCGC
GGGCGCGAGCAGGTCTGGGGCGCGACGCTCGCGCCCGACGAACGTCCCGAGGGCGGGGCGGTCGACCGCG
AGGCCCGGGCGCTCTGGCAGGAACTCGAGGCCCGCGTCGGGCCGCGGCTGGCCGAGGAGGCCACGCTGGC
CGACCGGGCCGAGATCTTCCGCTTCCCCGCGCGGATGGCCGAGGTCGAGGCGCCGCTGCGGGTGCTGATC
GCCACCCTCTTCGGCGAGAGCCGCTACGAGGACAGCCCCTGGCTCCGCGGCTTCTACTTCACCTCGGCCA
CGCAGGAGGGCTCGCCGATCGACCGGATGCTCGGGGAGCTGGCGGGCGCCTTCGGCCTCAGCGCGCCCGC
GCCTCCCCGCCGGGCGCGGGGCGAGACACGCACCTATTTCCTGCACGATCTTCTGGCGAAGGTGATCTTC
CCGGAAGCCGGGCTGGGACGCCTCGACCGGGCGGCCGAGGAGAGGCGCCGCTGGCTCTGGCGCGGCTCGG
TGGCGGGCGCGGCCCTTGCCACGGCGGTGGCGGGGGTGGGGTTCCTCCTTTCGTTCCTCGGCTGGTCGGG
CGCCATCGAGGATCAGGCGCGGCTGACCGCGGATCTCTCCGCCCGGCTGGCCAATGTGGCCGCGCGGCAG
GCGCCGACCGAGCCGCTGGACCTGCCCCTCGCGCTGGACGCCGCGACTGCCGCGGACGCCGCACGCACGG
AGCCGCCCTCGGGCCCCTTCGCCCTCATCGGCCCCTCGGCCGCGGCCGAGATCGAGCGGGCGGGCACCAT
CGCCTACGAGCGCACGCTGGCCAATGTGCTCGCGCCGCGGATGGTGGCGCTGCTCGAGGCCTCGATGTGG
CGGCAGGTGCGCGATCCCGACGACATGTTGGGCGCGCTCAAGGCCTATTTCATGCTCACGGGCCTCGCGC
CCTACGACCGCGACTTCCTGACCGGCTGGTGGCAGGAAGAGCTGCCGCAGCAGGCGGTGCTCGACCCGTT
TCCGACCGAGGCGGCCCGCAGGCACCAGCTGGCTGCGCTTTCCCTTTTCGGCACGCAGGGCGACCCCATC
CCGCCCGACGAGGAGCTGGTGGCGGCGGCGCTCGCCAGCATCTGCACCATCCCCCTCGCGGCCCGCGCCT
ATGGCGCGCTGATGCAGGATCCCGCGGTCACGGGCCTGCCCGACTGGATCCCGGGCGACCGCGCCGGGCC
GAACGGCGCGAGGATCTTCACCCGCCTCTCGGGCAAGACGCTGCGGGTGGGGCTGCCCGGCGCCTTCACC
TTTGCGGGCTTTCAGGAGACGATCCTGCCGCTCGTGCCGGAAGTCGCCGCGCAGGCTACGCTCGACCGGA
CCCTCTTTGCGGGCGGCTGCGGCGGCAGCGCCGGGGCCTCGGCCGCCACGCTCGAGGCGGACATCCTGAA
ACTCTATTCCGACGATTTCATCGCGCGCTGGGACGGGCTTCTGCGCGACATCCGGCTGGCGCCGCTGACG
GATTTCGCCACCGCCACTGCGGCGATGAAGGATCTGGCGAGCCCGGACAGCGCGCTGAAGCGGCTGCTCG
CTGCGGTCGTGGCCGAGACCGACCTCACGCGCGTTCCCGCTTCCGATGCGGCGCCGCCCGAGGGTCTCCT
TAACGCCGCGAGCAAGAAGCTCGGGAAGGTGGGCAAGCTCGTGAAGGGGGCCGCGTCGCTGACGGTGGGC
TCCGCGCCGCCTGCGGAGCCGCCGGGGCTGGCGGTGGCGCGCCATTTCGAGCCGCTGAAGGGGATGGTGG
CCGAGGTGGAGGGCGTGCCGCCGCGGATCGGGGATGCCGAACTCGCGCTCGGCGCGCTGGCCAATGCGCT
TCAGACCGCGGCGGCCAATCCCGATCCGCAGGCGGCGCTGACCGCGCAGGGGGGGCTTGCCACGCTGACC
GGCGGGCTGACCGAGGTCGCCGCCCGCCTGCCGCCCCCCATCGACGCCTGGCTCGAGGGGCTGGCCACGG
ACGCGGCCAGCGTGACGCGCGAGGCGGCGATCGACCGGCTGAACGCGCGCTACCGGGCCGACATCCTGCC
CTTCTGCCGCGCCGCCACCGCGGGCCGCTATCCGTTCGAGCCGGGCTCGGCCATCGATGTGAATACCGCC
GATTTCCAGCGCCTCTTCGGGCCCGGCGGCCTGTTCGACGGCTTCACGGGCGACGCGCTCGGGCCCTGGA
TCGACACGACGCGGCATCCCTGGGCGTGGCGCGCCGATCTGGGGCTCGATGCCCGGAGCCTCGCGCCCTT
CGAGGCCGCCCGGCGGATGCGCGACGGTCTCTTCGCCGGAGGCATCGGCCCGGTGATGGGCTTCCTGCTT
CAGGCGACGGACCTGTCGCCCAATGCCGCCCGCGTGACGCTGAGCCTCGACGGCCAGCAGCTTGTCTACA
TGAATGCGGCCACGCCCCCCGTGGGCATGACCTGGCCCGGCCAGAACGGAACGAACCTCATCGTGCTCTC
CTTCACGCCGCTCGACGGATCGGCCGAGGCGGTGACCTCGGAATCCGGCGCCTGGGCCTGGCTCCGGCTG
ATCGGCAAGGGCAGCCTCTCGCCCACCGCGCAGCCCGACTTGTTCCGGCTGCGCCTCGCCGCCGGAGCCT
ATGCCGCGCGCTTCGATCTCCGGGCGAATTCGGTGGAGAACCCGCTCGACCTCAGGCTCTTCGGCGGGTT
CCGCTGCCCGGATGGCTTCTGA
 Primer design