SecReT6
Protein ID: 221369492
SecReT6 ID328
T6SS typei3
Gene symbol-
Locus tagRSKD131_3655
StrainRhodobacter sphaeroides KD131
Repliconchromosome II [GenBank: NC_011958] [Browse all T6SS(s) in this replicon]
Location [Strand]581526..583934 [-]
Producthypothetical protein
NoteTssM
UniProt IDB9KTY7
KEGG IDrsk:RSKD131_3655
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 6.20E-42, Aligned region: 198..483
DUF1215 [PF06744], Evalue: 8.40E-26, Aligned region: 554..671
Protein Sequence: 802 a.a.     [Download]
>gi|221369492|ref|YP_002520588.1| hypothetical protein RSKD131_3655 [Rhodobacter sphaeroides KD131]
MPQDLARGPASDPFACAAAPALAFAEELGRRRDPPAALAAEARAHLDRFGRALAGEVAAAAVPPARYALA
LVIDRQARANPSLDLRLWEAAARAQLFDGRALGEPDLRRFLRSAAEAGPAFAPVQPFLQACLDRLEARRT
RLQPPAVESWRGIGAILAASFGLAVAGWALHVEWSFHRRLAEAFEARAAEAAALPLRARLDMLAEAASGV
ATEVQQAPVALAAGPLGFDAAAGAAAAYRAELQATLPAVLVQAVEEAIASEADPAASYDTVRAWAILSRA
ADWSPAWLAGWLDRPAAPTEMRGLARHVRQLSPPEGPLPQPDADLLAQARAFAAEASEADRVWLELLRSE
GAAALPPWRAEAAVPGLASVVMRRSGAALDAPVPGLFTAAGWTYARDRGTGLAVQAARREARLLDRPTAE
TNASADRVLELLQAETLARWQALLADLRVVPFQTADTAVRVSGALARPESPLTQLLREVWHQVGGEDPLR
PHALQLKIAAVFGPARQFVDQGGMTRIAALFAALNAALGGLDRDSPTGLQRLMQAEDRARSIATLRQAPA
LVVEIIEDLLAQAGSAQAAGLTNPLTAAWQAEVLPLCRATLDGRYPFAEGADADPAAVERLLGRNGALAA
FVAARAAPYLDQSASPWRWKPEARFAGLSPDSAAFLERASAAGPGLTGPRALTLTALAERGTAAVMLGGQ
GGPVTTTSDSLRLDWPGLQPDRGAEIALRTPEGAARLAAPGPWGLLRLLEPFRLRPREGGLRFLIDLRSG
GARLFLEAAFDAAPNPLSVRRLVRGLACPQVL
 
Nucleotide Sequence: 2409 bp     [Download]
>gi|221368938|ref|NC_011958.1|:c583934-581526 Rhodobacter sphaeroides KD131 chromosome 2, complete sequence
ATGCCGCAGGATCTCGCCCGAGGCCCCGCCTCCGATCCGTTCGCCTGCGCCGCGGCCCCCGCGCTGGCCT
TCGCCGAGGAGCTGGGCCGGAGGCGCGATCCTCCCGCCGCGCTGGCGGCCGAGGCCCGGGCGCATCTCGA
CCGGTTCGGGCGCGCGCTTGCAGGTGAGGTTGCTGCGGCCGCGGTGCCACCCGCGCGTTATGCGCTGGCG
CTGGTGATCGACCGGCAGGCGCGCGCGAACCCGAGCCTCGACCTGCGTCTGTGGGAGGCGGCCGCGCGCG
CGCAGCTCTTCGACGGTCGCGCTCTGGGCGAGCCGGACCTGCGCCGCTTCCTCCGCAGCGCCGCCGAGGC
CGGGCCCGCCTTCGCGCCGGTGCAGCCGTTCCTGCAGGCCTGCCTCGACCGGCTGGAGGCCCGGCGGACA
CGCCTCCAGCCGCCCGCCGTGGAAAGCTGGCGCGGGATCGGGGCAATTCTGGCCGCCTCCTTCGGGCTCG
CGGTGGCGGGCTGGGCGCTGCATGTCGAATGGAGCTTCCATCGGCGGCTGGCCGAGGCCTTCGAGGCCCG
TGCCGCGGAGGCGGCGGCCCTGCCGCTCCGCGCGCGGCTCGACATGCTCGCGGAGGCGGCGTCCGGTGTC
GCGACCGAGGTGCAGCAGGCGCCGGTCGCGCTGGCCGCGGGGCCTCTCGGCTTCGATGCGGCGGCCGGTG
CCGCGGCAGCCTACCGCGCCGAGCTGCAGGCCACGCTGCCGGCGGTTCTGGTGCAGGCCGTCGAGGAGGC
CATCGCCTCCGAGGCCGATCCGGCGGCGAGCTACGACACGGTGCGGGCCTGGGCGATCCTGAGCAGGGCG
GCCGACTGGTCGCCCGCCTGGCTTGCGGGCTGGCTCGACCGTCCGGCGGCCCCGACGGAGATGCGGGGCC
TCGCGCGGCATGTGCGGCAGCTGTCGCCGCCCGAGGGACCCCTGCCGCAGCCGGATGCCGACCTTCTGGC
GCAGGCCCGCGCCTTTGCCGCCGAAGCGTCCGAGGCCGACCGCGTCTGGCTCGAACTCCTGCGCTCGGAA
GGGGCGGCGGCCCTTCCCCCTTGGCGCGCCGAGGCGGCGGTGCCGGGGCTGGCTTCCGTGGTGATGCGCC
GGTCCGGGGCCGCGCTCGACGCGCCGGTCCCCGGCCTCTTCACGGCGGCGGGCTGGACCTACGCCCGCGA
CCGCGGCACCGGGCTGGCGGTGCAGGCGGCGCGGCGCGAGGCGCGGCTGCTCGATCGGCCGACGGCCGAG
ACCAACGCCAGCGCCGACCGCGTGCTGGAGCTGCTGCAGGCCGAGACGCTCGCCCGGTGGCAGGCGCTGC
TCGCCGATCTGCGCGTGGTGCCCTTCCAGACCGCCGACACGGCCGTGCGGGTCTCGGGCGCGCTGGCGCG
GCCCGAGTCGCCGCTCACGCAGCTTCTGCGCGAGGTCTGGCATCAGGTGGGCGGCGAGGATCCGCTGCGG
CCCCATGCGCTGCAGCTGAAGATCGCGGCCGTCTTCGGCCCCGCAAGGCAGTTCGTGGATCAGGGCGGCA
TGACACGGATCGCTGCGCTCTTCGCGGCGCTGAATGCGGCTCTGGGGGGCCTCGACCGCGACAGTCCGAC
GGGCCTCCAGCGGCTGATGCAGGCCGAGGACCGGGCGCGCAGCATCGCCACGCTGCGGCAGGCGCCCGCG
CTGGTGGTCGAGATCATCGAGGATCTGCTGGCGCAGGCGGGCTCGGCGCAGGCCGCGGGCCTCACGAACC
CGCTGACGGCGGCGTGGCAGGCCGAAGTGCTGCCGCTCTGTCGCGCGACGCTCGACGGGCGCTATCCGTT
CGCCGAGGGGGCCGACGCCGACCCAGCCGCGGTGGAGCGGCTTCTGGGCCGGAACGGGGCGCTCGCGGCC
TTCGTGGCGGCGCGCGCCGCGCCCTATCTCGACCAGAGCGCCAGCCCCTGGCGCTGGAAGCCCGAGGCGC
GCTTCGCCGGGCTTTCCCCCGACAGCGCGGCCTTCCTCGAACGGGCGAGCGCCGCAGGTCCGGGCCTGAC
CGGGCCGAGGGCGCTCACGCTCACCGCTCTGGCCGAGCGGGGCACCGCCGCGGTGATGCTGGGCGGGCAG
GGCGGCCCCGTCACCACCACGAGCGACAGCCTGCGGCTCGACTGGCCCGGCCTGCAGCCCGACCGCGGCG
CCGAGATCGCCCTGCGCACGCCCGAAGGCGCGGCGCGGCTGGCGGCGCCGGGGCCCTGGGGCCTCTTGCG
GCTCCTCGAGCCCTTCCGGCTGCGCCCCCGCGAGGGCGGGCTGCGGTTCCTCATCGACCTGCGCTCCGGC
GGCGCGCGGCTCTTTCTCGAAGCCGCCTTCGACGCGGCGCCGAACCCGCTCTCGGTGCGACGACTCGTGC
GCGGGCTCGCCTGTCCGCAGGTCCTGTGA
 Primer design