SecReT6
Protein ID: 222106978
SecReT6 ID329
T6SS typei5
Gene symbolimpL
Locus tagAvi_6041
StrainAgrobacterium vitis S4
Repliconchromosome II [GenBank: NC_011988] [Browse all T6SS(s) in this replicon]
Location [Strand]1056348..1059842 [-]
ProductIcmF family protein
NoteTssM
UniProt IDB9K2F5
KEGG IDavi:Avi_6041
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 2.40E-73, Aligned region: 204..447
ImcF-related_N [PF14331], Evalue: 2.40E-73, Aligned region: 516..588
IcmF-related [PF06761], Evalue: 5.80E-64, Aligned region: 497..797
DUF1215 [PF06744], Evalue: 3.40E-32, Aligned region: 727..754
DUF1215 [PF06744], Evalue: 3.40E-32, Aligned region: 905..1026
Protein Sequence: 1164 a.a.     [Download]
>gi|222106978|ref|YP_002547769.1| IcmF family protein [Agrobacterium vitis S4]
MINPLSWFYTIRSYVDSYAGVVGRRFISLIWVIALCVLIWFYGYLAAFGSFKPLASVSARIWTMVVIFAI
WTAYMIVTMVRAKRQDKELVDSIEAQALANQQAEVSEISNRLKEALALLRRITKKRFGYIYELPWYVIFG
APGSGKTTALTNSGLQFPLGDALGSDAVKGIGGTRNCNWWFADQAIMIDTAGRYTTQDDLDGSSKAGWEG
FLGLLRRYRRSQPVNGALLTLSIGDLLTRDPEAQREELRAIRKRLAELDDHLGARVPVYILLTKADLLTG
FVEFYDSFNKSDREQVWGTTFGLEESYGAKTLPERFAEEFALLQQRVDAMLIERLQQEQSADVRGRIFRF
PAELASLQEKLGEAISELCTGSSLVEAPLIRGIYFVSATQPDETLARTTTNRTRRSYFLPKLFSEVIFNE
AALVARDKRLSSRQVLLRQAVWGLAVAAVVIVFAGWTMTFFQNRAALAQAEEHLNAYDKLIQDVPVRNVS
DADFLRVLPALDNLRAVPTGFDTRYVWAASFGLSQRDKIAGRQRDAYQRALNSLLLPRMLVQLQKDLTGE
SDVTRTFNALKLYEMLGGLGRLDREFVSAQATQMFNALYPGEGRTAARKALIQHASAMAAGVLPPVEIDR
RLIEKARDTIRNQTVAERAFDILAGSKQAQALMPWQPSLAFGALGEKAFIRKSGALLTEGVEGLFTATGY
RSVVLPHIADAAREALQEEWVRGSNAQLRGQTLESVAQAALQIYYDRLEQRWASVLGDLAVRPSQNLGDA
VETTRILSNDRNIVAQAARSIADATDLRPKGDTAGMTTLVSSASGDTVAAMLASSMAAPDPYSRLREALD
TPAADDSRKATTDKQDKPASQVEAILPVITALHDQLARSVTSSAEVAKVFDVDSQLTRANQDLLQDARRL
PGPLDGWMAGLAADTGSLAVKSARSRIGDLWSSEGAGLCSSIVTGRYPFDRASSRDVAMNDFIRLFGPKG
LFQTFFKQRMEPFVDQSISPWGWKGTFGAAGIPSEGIAEFERADQIFRAFFPNGSETPAIAINVKPVSLG
ETSTAVMLEIQGERVVYFHGPVQAKTITWPSKDAASMSRIAFQPGGWQQAKTENGDWSPFRLFDDANIQN
QGDDLFRAKFTNDNQVAEFDVQFGSVLNAFRLKALSEFTCPTQF
 
Nucleotide Sequence: 3495 bp     [Download]
>gi|222106127|ref|NC_011988.1|:c1059842-1056348 Agrobacterium vitis S4 chromosome 2, complete genome
GTGATCAATCCACTCAGCTGGTTTTACACCATACGCTCCTATGTCGATTCCTACGCGGGTGTCGTGGGGC
GGCGCTTTATATCGCTGATCTGGGTCATCGCCCTTTGCGTGCTGATCTGGTTCTACGGCTATCTGGCCGC
CTTCGGCAGCTTCAAGCCACTCGCCAGCGTTTCCGCCCGCATCTGGACCATGGTGGTGATCTTTGCCATC
TGGACCGCCTATATGATTGTCACCATGGTCCGCGCCAAGCGCCAGGACAAGGAACTGGTCGACAGTATCG
AGGCGCAGGCGCTGGCCAACCAGCAGGCCGAAGTCAGCGAAATCAGCAACCGGCTGAAAGAAGCGCTGGC
CTTGCTGCGGCGGATTACCAAGAAACGCTTCGGCTATATCTATGAGCTGCCATGGTATGTGATTTTCGGG
GCACCCGGCTCTGGCAAAACGACGGCGCTGACCAATTCTGGCCTGCAATTTCCGCTTGGCGACGCCCTTG
GCAGCGATGCCGTCAAGGGCATTGGCGGCACGCGCAATTGCAATTGGTGGTTCGCCGATCAGGCGATCAT
GATCGACACCGCTGGCCGCTATACGACCCAGGATGACCTCGATGGATCATCGAAAGCCGGATGGGAAGGG
TTTCTCGGCCTGTTGCGCCGTTATCGCCGTTCGCAGCCGGTCAATGGCGCGCTGCTGACGCTTTCCATCG
GCGACCTGTTGACCCGCGACCCGGAAGCCCAGCGAGAAGAACTGCGTGCGATCCGCAAGCGGCTGGCCGA
ACTGGACGACCATCTCGGTGCCCGCGTGCCGGTCTATATCCTGCTAACCAAGGCCGATCTTCTCACCGGT
TTCGTGGAATTCTACGATAGTTTCAACAAGAGCGACCGCGAACAGGTCTGGGGCACGACCTTCGGCCTGG
AAGAAAGCTACGGCGCAAAGACATTGCCGGAGCGTTTTGCCGAGGAATTCGCCCTGTTGCAACAGCGTGT
CGATGCCATGCTGATCGAGCGTCTGCAACAGGAGCAAAGTGCTGATGTGCGGGGCCGGATTTTCCGTTTT
CCGGCCGAGCTTGCCAGTTTGCAGGAGAAGCTCGGTGAGGCGATCAGCGAGCTTTGCACCGGCTCGTCAT
TGGTCGAGGCTCCGCTGATCCGTGGTATCTATTTCGTCTCCGCGACACAACCGGATGAAACCCTGGCCCG
CACCACGACAAACCGGACGCGGCGCAGCTATTTTCTGCCGAAACTGTTCAGCGAGGTGATTTTCAACGAA
GCGGCCCTGGTTGCACGCGACAAGCGCCTTTCCTCTCGCCAAGTCCTGCTGCGCCAGGCCGTCTGGGGTT
TGGCTGTGGCGGCGGTGGTCATTGTGTTTGCCGGATGGACCATGACGTTTTTCCAGAACCGGGCCGCTCT
CGCCCAGGCCGAAGAACATCTGAACGCCTATGACAAGCTGATCCAGGATGTGCCGGTGCGCAATGTGTCG
GATGCCGATTTTCTGCGCGTCCTGCCTGCGCTGGACAATCTGCGTGCGGTTCCAACCGGCTTTGACACCC
GCTATGTCTGGGCCGCAAGTTTCGGCCTCAGCCAGCGCGACAAGATTGCCGGTCGCCAGCGCGACGCCTA
TCAGCGCGCACTGAACAGCCTTTTGTTGCCCCGTATGCTGGTGCAATTGCAAAAGGACCTGACCGGTGAA
AGCGATGTAACGCGTACCTTCAATGCGCTGAAACTCTATGAAATGCTGGGTGGACTGGGGCGGCTTGACC
GGGAATTCGTCTCCGCCCAGGCAACCCAGATGTTTAACGCCTTGTATCCCGGCGAAGGCCGGACAGCGGC
CCGCAAAGCGCTGATCCAGCATGCCAGTGCCATGGCAGCCGGCGTATTGCCGCCAGTCGAAATCGACAGA
CGGCTCATCGAAAAGGCCCGCGACACCATCCGCAATCAAACCGTTGCCGAACGTGCTTTCGACATTCTGG
CCGGATCGAAACAAGCGCAGGCGCTGATGCCGTGGCAACCGTCGCTTGCCTTTGGCGCGCTGGGTGAAAA
AGCCTTCATCCGTAAGTCCGGCGCGCTGCTGACGGAAGGGGTCGAGGGACTGTTTACCGCGACCGGCTAC
CGCAGCGTCGTCCTGCCGCATATTGCCGACGCCGCCCGCGAAGCGCTGCAAGAAGAATGGGTGCGCGGCT
CCAATGCGCAATTGCGGGGGCAAACGCTGGAGTCAGTGGCCCAGGCGGCCTTGCAAATCTATTATGACCG
GCTTGAACAGCGCTGGGCGTCCGTGCTGGGAGATCTAGCCGTCAGGCCGTCGCAAAACCTGGGCGATGCC
GTGGAAACCACACGCATCCTTTCCAATGACCGCAATATCGTCGCCCAGGCCGCCAGATCGATAGCCGATG
CGACGGATCTGCGCCCGAAGGGCGATACGGCGGGCATGACCACGCTGGTGTCATCCGCCAGCGGCGACAC
AGTTGCTGCCATGCTAGCATCCTCCATGGCCGCCCCTGATCCCTATAGCCGCTTGCGCGAGGCGCTGGAT
ACGCCTGCCGCAGACGATAGCCGCAAGGCAACAACAGATAAACAGGATAAACCCGCCTCCCAGGTCGAGG
CGATATTGCCAGTTATCACGGCGCTGCATGACCAGCTGGCCCGCTCGGTTACGTCCTCAGCGGAGGTGGC
GAAAGTATTCGATGTCGATAGCCAACTGACACGGGCCAATCAGGACCTGCTCCAGGATGCCCGCCGCCTA
CCGGGACCGCTGGATGGCTGGATGGCCGGACTTGCCGCCGATACCGGCTCACTCGCCGTCAAATCGGCCC
GCAGCCGGATTGGCGACCTGTGGTCGAGCGAAGGGGCGGGCCTGTGCAGCTCCATCGTTACGGGCCGCTA
CCCCTTCGACCGCGCTTCCAGCCGCGATGTCGCCATGAACGACTTCATCAGGCTTTTTGGACCGAAGGGC
CTGTTCCAGACGTTCTTCAAGCAAAGGATGGAGCCCTTCGTCGATCAGTCGATCTCCCCCTGGGGTTGGA
AGGGCACCTTCGGCGCGGCAGGCATTCCCAGCGAGGGTATTGCCGAGTTTGAAAGGGCCGACCAGATCTT
CCGCGCCTTCTTCCCAAATGGCAGCGAGACACCGGCGATTGCCATCAATGTCAAGCCGGTGTCGCTTGGC
GAGACCTCGACGGCGGTGATGCTGGAAATCCAGGGCGAACGGGTGGTATATTTCCATGGCCCGGTCCAGG
CGAAAACCATAACCTGGCCATCGAAGGATGCCGCCAGCATGTCGCGGATTGCCTTCCAGCCCGGCGGCTG
GCAACAGGCCAAAACCGAAAATGGCGACTGGTCGCCTTTCCGCCTGTTTGACGATGCAAATATCCAAAAC
CAAGGCGACGATCTGTTTAGGGCGAAATTCACCAACGATAACCAGGTGGCGGAATTCGATGTGCAGTTTG
GTTCGGTGTTGAATGCCTTCAGGCTGAAGGCGCTGTCCGAATTTACCTGCCCGACCCAGTTCTGA
 Primer design