SecReT6
Protein ID: 222155037
SecReT6 ID795
T6SS typei1
Gene symbol-
Locus tagLF82_013
StrainEscherichia coli LF82
Repliconchromosome [GenBank: NC_011993] [Browse all T6SS(s) in this replicon]
Location [Strand]242397..242876 [-]
Producthypothetical protein
NoteTssD
UniProt IDQ6TKT6
KEGG IDelf:LF82_013
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.90E-31, Aligned region: 6..143
Protein Sequence: 159 a.a.     [Download]
>gi|222155037|ref|YP_002555176.1| hypothetical protein LF82_013 [Escherichia coli LF82]
MANPVYLTLNGELQGLISSGCSSMPSIGNKAQIAHQDQIMVTSLSHGLSRAQNVNHQELTITKPVDKSSP
LLGKAISENECLTCDFVFYRTNRFGINEPYYKLKLANARLSNIGLTVPHTINDSPGQAEESVSFTYESIN
WEHSVAGTSAYSLWSERIF
 
Nucleotide Sequence: 480 bp     [Download]
>gi|222154829|ref|NC_011993.1|:c242876-242397 Escherichia coli LF82, complete genome
ATGGCAAATCCCGTCTATCTGACACTGAACGGAGAACTTCAGGGGCTGATTTCATCCGGATGCTCGTCAA
TGCCGTCCATCGGTAACAAAGCCCAGATTGCACATCAGGATCAGATCATGGTGACGTCACTGTCCCATGG
TCTGAGCCGTGCGCAGAATGTCAACCATCAGGAGTTGACCATCACGAAACCGGTGGACAAATCCTCCCCT
CTGCTGGGCAAGGCCATTTCAGAGAATGAATGTCTGACCTGTGATTTTGTATTCTACCGCACCAACCGCT
TTGGAATTAATGAACCGTACTACAAGCTGAAACTGGCTAACGCCCGGCTCTCAAACATCGGCCTTACCGT
TCCCCATACCATTAACGACAGTCCTGGGCAGGCGGAAGAGTCTGTGTCATTTACCTATGAGAGCATCAAT
TGGGAGCACAGCGTCGCCGGAACCAGTGCATACAGCCTTTGGAGTGAACGGATTTTCTAA
 Primer design