SecReT6
Protein ID: 222155039
SecReT6 ID795
T6SS typei1
Gene symbol-
Locus tagLF82_015
StrainEscherichia coli LF82
Repliconchromosome [GenBank: NC_011993] [Browse all T6SS(s) in this replicon]
Location [Strand]244263..247751 [-]
Producthypothetical protein
NoteTssM
UniProt IDE2QFZ4
KEGG IDelf:LF82_015
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 1.30E-82, Aligned region: 494..807
ImcF-related_N [PF14331], Evalue: 9.00E-60, Aligned region: 197..444
ImcF-related_N [PF14331], Evalue: 9.00E-60, Aligned region: 805..872
DUF1215 [PF06744], Evalue: 1.60E-32, Aligned region: 292..310
DUF1215 [PF06744], Evalue: 1.60E-32, Aligned region: 903..1021
Protein Sequence: 1162 a.a.     [Download]
>gi|222155039|ref|YP_002555178.1| hypothetical protein LF82_015 [Escherichia coli LF82]
MKSALRPAMPRFKVSATWLLTLAWIFLLVWIWWQGPKWTLYEQHWLAPLANRWLATAVWGLIALVWLTWR
VMKRLQKLEKQQKQQREEEKDPLTVELHRQQQYLDHWLLRLRRHLDNRRYLWQLPWYMVIGPAGSGKSTL
LREGFPSDIVYTPESIRGVEYHPLITPRVGNQAVIFDVDGVLTTPGGDDLLRRLREHWLGWLMQTRARQP
LNGLILTLDLPDLLTADKSRRETLVQNLRQQLQEIRQSLHCRLPVYVVLTRLDLLNGFAALFHSLDKKDR
DAILGVTFTRRAHESDGWRSELGAFWQTWVQQVNLALSDLVLAQTGAAPRSAVFSFSRQMQGTGEIVTAL
LAALLDGENMDVMLRGVWLTSSLQRGQVDDIFTQSAARQYGLGNSSLATWPLVETTPYFTRRLFPEVLLA
EPNLAGENSVWLNSSRRRLTAFSTCGAALAALMVGSWHHYYNQNWQSGVNVLAQAKAFMDVPLPQGTDEF
GNLQLPLLNPVRDATLAYGDYRDHGFLADMGLYQGARVGPYVEQTYIQLLEQRYLPSLMNGLIRDLNIAP
PESEEKLAVLRVVRMMEDKSGRNNEAVKQYMARRWSNEFHGQRDIQAQLMVHLDYALEHTDWHAQRQSSD
SDAVSRWTPYNKPVINAQHELSKLPIYQRVYQTLRTKALSVLPADLNLRDQIGPTFDNVFVAGNDEKLVI
PQFLTRYGLQSYFIKQHDGLVELTALDSWVLNLTQSVAYSEADREEIQRHITEQYLSDYTATWRAGMDNL
NVRDYETMPALTDALEQIISGDQPFLRALTALRDNTHALTLSGKLDDKAKEAAINEMDYRLLSRLGHEFA
PENSALEEQKDKASTLQAVYQQLTELHRYLLAIQNSPVSGKSALKAVQLRLDQNSSDPIFATRQMAKTLP
APLNRWVGKLADQAWHVVMVEAVRYMEVDWRDNVVKPFNEQLADNYPFNPHATQDASLDSFERFFKPDGI
LDNFYKNNLRLFLENDLTFGDDGRMLIREDIRQQLDTAQKIRNIFFSQQNGLGAQFAVETVSLSGNKRRS
VLNLDGQLVDYSQGRNYTAHLVWPNNMREGNESQLTLIGTSGRAPRSIAFSGPWAQFRLFGAGQLTNVTS
DTFNVRFNVDGGAMVYRVHVDTEDNPFTGGLFSQFRLPDTLY
 
Nucleotide Sequence: 3489 bp     [Download]
>gi|222154829|ref|NC_011993.1|:c247751-244263 Escherichia coli LF82, complete genome
TTGAAATCTGCGCTCAGGCCAGCGATGCCGCGGTTTAAAGTTTCTGCCACCTGGCTACTGACGCTGGCAT
GGATTTTTCTGCTGGTGTGGATCTGGTGGCAGGGTCCAAAATGGACGCTCTATGAGCAGCACTGGTTGGC
TCCGCTGGCAAACCGCTGGCTGGCGACCGCCGTCTGGGGACTTATCGCTCTGGTCTGGCTCACCTGGCGG
GTGATGAAGCGTCTGCAAAAGCTGGAAAAACAGCAGAAACAGCAGCGGGAGGAAGAAAAAGATCCGTTGA
CCGTGGAACTCCACCGCCAGCAGCAATATCTGGATCACTGGCTGCTGCGCCTGCGCCGCCATCTGGATAA
CCGCCGTTATCTGTGGCAGTTGCCGTGGTATATGGTCATTGGTCCTGCGGGTAGCGGCAAAAGCACGCTG
CTGCGCGAGGGCTTTCCGTCTGACATTGTTTACACGCCGGAAAGCATCCGGGGTGTGGAATACCACCCGC
TGATCACACCGCGAGTGGGCAACCAGGCGGTAATTTTCGATGTTGACGGCGTACTGACCACTCCCGGCGG
GGATGATCTGCTCCGCCGCCTGCGCGAACACTGGCTGGGCTGGCTGATGCAAACGCGCGCTCGCCAGCCG
CTCAACGGTCTTATCCTGACGCTCGATCTTCCCGATCTGCTGACGGCGGATAAATCCCGCCGTGAGACAC
TGGTACAAAATTTGCGCCAGCAACTTCAGGAGATCCGTCAGAGCCTGCACTGCCGTCTGCCCGTTTACGT
GGTGCTGACACGGCTGGATCTGCTGAACGGCTTTGCCGCGCTGTTCCATTCACTGGATAAAAAAGACCGC
GATGCGATCCTCGGCGTCACATTTACCCGCCGCGCCCATGAAAGTGACGGCTGGCGCAGCGAACTGGGGG
CTTTCTGGCAGACGTGGGTACAACAGGTGAACCTGGCGCTGTCGGATCTGGTGCTCGCACAAACCGGTGC
TGCTCCCCGCAGCGCTGTGTTCAGCTTCTCCCGTCAGATGCAGGGAACAGGAGAAATCGTCACCGCACTG
CTCGCCGCATTGCTGGACGGTGAGAACATGGATGTAATGCTGCGTGGCGTCTGGCTCACATCCTCGCTAC
AGCGTGGCCAGGTGGATGATATTTTCACGCAGTCCGCCGCCCGCCAGTACGGACTGGGTAACAGCTCGCT
GGCAACCTGGCCTCTGGTGGAGACGACGCCGTATTTTACTCGCCGCCTCTTCCCGGAAGTCCTGCTGGCT
GAGCCGAACCTGGCGGGTGAAAACAGCGTCTGGCTGAACAGCTCCCGGCGCAGGCTGACCGCCTTTTCCA
CCTGTGGCGCGGCACTGGCGGCATTGATGGTCGGAAGCTGGCACCATTATTACAATCAGAACTGGCAGTC
TGGCGTTAACGTACTGGCACAAGCTAAAGCCTTTATGGACGTACCACTACCGCAGGGAACGGATGAATTC
GGCAATCTGCAATTGCCATTGCTTAACCCGGTACGCGATGCCACCCTGGCCTATGGTGATTATCGCGATC
ACGGTTTTCTGGCGGATATGGGATTGTACCAGGGCGCCCGCGTAGGGCCGTATGTGGAGCAAACCTACAT
TCAGCTTCTTGAGCAGCGTTATCTCCCCTCGTTAATGAACGGCCTGATCCGGGATCTAAACATTGCCCCG
CCAGAGAGCGAAGAAAAGCTCGCTGTGCTGCGCGTAGTGCGCATGATGGAAGACAAAAGTGGGCGCAACA
ACGAGGCGGTAAAACAGTACATGGCGCGGCGCTGGAGCAATGAATTTCACGGCCAGCGCGATATTCAGGC
GCAACTGATGGTGCATCTGGACTATGCGCTGGAGCACACCGACTGGCACGCGCAGCGCCAAAGCAGCGAC
AGCGATGCTGTAAGCCGCTGGACCCCCTATAATAAACCGGTCATTAATGCGCAACATGAACTGAGCAAGC
TACCCATATACCAGCGTGTCTACCAGACCCTTCGCACCAAAGCATTAAGCGTGTTACCCGCCGATTTGAA
TTTGCGCGACCAGATTGGTCCCACCTTCGACAACGTGTTCGTCGCCGGTAATGATGAAAAACTGGTGATC
CCGCAGTTTCTCACCCGCTATGGCCTGCAAAGCTATTTTATCAAACAACACGACGGTCTCGTTGAGTTGA
CCGCGCTGGATTCGTGGGTGCTGAACCTGACGCAAAGCGTCGCCTACAGCGAGGCCGACCGTGAAGAGAT
CCAGCGCCATATCACTGAACAGTACCTCAGTGACTATACCGCTACATGGCGTGCCGGAATGGATAATCTC
AACGTCCGTGACTATGAGACCATGCCGGCGCTGACCGACGCGCTGGAGCAGATTATCAGCGGTGATCAGC
CATTCCTGCGTGCTCTGACGGCGCTGCGCGATAATACACACGCGCTGACGCTCTCCGGCAAACTGGACGA
TAAGGCGAAGGAAGCGGCGATAAATGAGATGGATTACCGCCTGTTATCCCGGCTGGGGCATGAGTTCGCG
CCGGAAAATAGCGCACTGGAGGAGCAAAAGGACAAGGCGAGTACTCTACAGGCCGTGTATCAGCAACTGA
CCGAGCTGCACCGTTACCTGCTGGCGATCCAGAACTCGCCAGTGTCTGGGAAATCGGCGCTGAAAGCAGT
ACAGCTACGGCTGGATCAAAACAGCAGCGATCCAATCTTCGCCACCCGTCAGATGGCAAAAACCCTGCCT
GCGCCTCTTAACCGCTGGGTAGGTAAGCTGGCGGATCAGGCCTGGCATGTAGTGATGGTGGAAGCCGTTC
GTTACATGGAAGTGGACTGGCGCGACAATGTAGTGAAACCCTTCAACGAGCAGCTTGCCGATAACTATCC
GTTTAATCCGCACGCCACACAGGATGCCTCACTGGATTCGTTTGAACGTTTCTTTAAACCGGATGGCATT
CTGGACAATTTCTACAAGAACAACCTGCGCCTGTTCCTTGAAAACGATCTGACCTTTGGCGACGACGGCA
GAATGTTAATCCGTGAAGATATCCGGCAGCAACTGGATACTGCGCAGAAAATCCGCAACATCTTCTTCAG
CCAGCAGAACGGGCTGGGCGCACAGTTTGCCGTGGAAACCGTATCGCTTTCCGGCAATAAGCGGCGCAGC
GTACTTAACCTGGACGGCCAGTTAGTGGACTACAGCCAGGGACGCAACTACACCGCCCATCTGGTCTGGC
CGAACAACATGCGTGAAGGCAATGAAAGCCAGCTGACGCTGATTGGCACCAGCGGCAGAGCACCGCGCAG
TATCGCGTTCAGCGGACCGTGGGCGCAGTTCCGCCTGTTCGGCGCGGGCCAGTTGACCAATGTGACCAGT
GACACCTTTAACGTGCGCTTTAACGTGGACGGCGGCGCGATGGTTTACCGGGTGCATGTGGATACCGAAG
ATAACCCGTTCACCGGCGGTCTGTTCAGCCAGTTCCGTTTACCGGATACGTTGTATTAA
 Primer design