SecReT6
Protein ID: 222155040
SecReT6 ID795
T6SS typei1
Gene symbol-
Locus tagLF82_016
StrainEscherichia coli LF82
Repliconchromosome [GenBank: NC_011993] [Browse all T6SS(s) in this replicon]
Location [Strand]247807..249249 [-]
Producthypothetical protein
NoteTssA
UniProt IDE2QFZ5
KEGG IDelf:LF82_016
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 5.70E-07, Aligned region: 54..111
Protein Sequence: 480 a.a.     [Download]
>gi|222155040|ref|YP_002555179.1| hypothetical protein LF82_016 [Escherichia coli LF82]
MAMDLRNPDVWLAHLLENLPEDKLSAALDDGNADWEFVDSEIVKLGSLAHSQLDIPELQRRGLMLLASET
KDFRLLAHLLRTLQHAGDILLASRMLAQYTEHYWTCAAPQNMAHKKRFAAQVIKRFESAVQDFAGNAATI
QRDALLGELAKLAQCWQAHNASELAKATDDLFSLFQRAFRDVAPEMTSSARSAAIAPQATTGYVPDMSPH
TVAAQPPVAATPIPQVTVESHDDKAWRDTLLKVAAILCERQPESPQGYRLRRHALWQTITSTPQAESDGR
TPLAAFPVDMMDDYLARLNNADMALWQQVEKSLLLAPYWLDGHYLSAQTALRLGYKQVADAIRDEVTDFL
ARLPALINLLFNDRTPFVSEQTKQWLASSGSVNQTVPVVQTDEELQAAKACFDEYGLEAALRYLENLPEG
DPRHQFHRQFFGAQLLEEAGMVQLAQQQYRMLFRTGLHMMLSEWEPSLLKALEQKLTAEQ
 
Nucleotide Sequence: 1443 bp     [Download]
>gi|222154829|ref|NC_011993.1|:c249249-247807 Escherichia coli LF82, complete genome
ATGGCAATGGACTTACGTAATCCCGATGTATGGCTTGCACACCTGCTGGAAAACCTGCCAGAAGATAAGC
TGTCCGCCGCGCTTGATGATGGCAATGCAGACTGGGAGTTTGTCGACAGCGAAATCGTCAAGCTCGGTTC
ACTGGCGCACAGCCAGCTTGATATCCCGGAACTTCAGCGCCGGGGCCTGATGCTTCTGGCCTCAGAAACC
AAAGATTTTCGCCTGCTGGCCCACTTGCTGCGTACCCTGCAACATGCCGGTGATATTCTGCTGGCCTCCA
GGATGCTGGCACAATATACAGAGCACTACTGGACATGCGCCGCACCGCAGAACATGGCCCACAAAAAACG
CTTTGCCGCCCAGGTGATAAAACGCTTTGAGTCTGCCGTTCAGGACTTTGCCGGGAATGCTGCGACAATA
CAGCGCGATGCTTTGCTGGGAGAGCTGGCAAAACTGGCACAGTGCTGGCAGGCGCACAACGCGTCTGAGC
TGGCAAAGGCGACAGACGATTTATTTTCCCTGTTTCAGCGCGCGTTTCGTGATGTAGCGCCTGAAATGAC
ATCATCTGCACGAAGCGCCGCCATTGCGCCGCAGGCCACGACCGGATATGTACCGGATATGTCACCGCAC
ACGGTTGCCGCTCAGCCTCCTGTTGCAGCCACTCCAATCCCGCAGGTCACCGTTGAAAGCCACGACGATA
AAGCATGGCGCGACACCCTGCTAAAGGTGGCCGCCATTCTCTGTGAGCGCCAGCCGGAGTCACCGCAGGG
TTACCGACTGCGCCGCCATGCGCTGTGGCAAACCATCACCAGTACCCCGCAGGCAGAAAGCGATGGCCGG
ACCCCACTGGCAGCCTTCCCTGTCGATATGATGGATGATTACCTGGCGCGGCTGAACAATGCCGACATGG
CGCTGTGGCAGCAGGTGGAAAAAAGCCTGCTGCTGGCCCCGTACTGGCTGGACGGTCATTACCTCTCAGC
ACAGACCGCGCTGCGCCTCGGTTATAAACAGGTGGCGGATGCTATCCGTGATGAAGTTACCGATTTTCTG
GCCCGCCTGCCCGCACTGATCAACCTGTTGTTTAACGACCGCACTCCGTTTGTGTCCGAACAGACGAAAC
AGTGGCTGGCATCATCCGGCTCAGTCAACCAGACCGTCCCGGTTGTACAGACCGATGAAGAATTACAGGC
GGCCAAGGCGTGCTTCGATGAATACGGGCTGGAAGCCGCGCTGCGGTACCTGGAAAACCTGCCCGAAGGT
GATCCCCGCCACCAGTTTCACCGCCAGTTTTTCGGCGCGCAGTTACTGGAAGAGGCCGGTATGGTTCAGC
TTGCACAACAGCAGTACCGGATGCTCTTCAGAACAGGATTACACATGATGCTATCCGAATGGGAGCCTTC
CCTGCTGAAAGCACTGGAACAAAAACTCACGGCAGAACAGTAA
 Primer design