SecReT6
Protein ID: 222155042
SecReT6 ID795
T6SS typei1
Gene symbol-
Locus tagLF82_018
StrainEscherichia coli LF82
Repliconchromosome [GenBank: NC_011993] [Browse all T6SS(s) in this replicon]
Location [Strand]249994..252756 [-]
Producthypothetical protein
NoteTssH
UniProt IDE2QFZ7
KEGG IDelf:LF82_018
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 9.10E-39, Aligned region: 27..46
AAA_2 [PF07724], Evalue: 9.10E-39, Aligned region: 640..801
AAA [PF00004], Evalue: 3.00E-16, Aligned region: 221..332
AAA [PF00004], Evalue: 3.00E-16, Aligned region: 646..763
AAA_5 [PF07728], Evalue: 1.20E-13, Aligned region: 40..74
AAA_5 [PF07728], Evalue: 1.20E-13, Aligned region: 220..240
AAA_5 [PF07728], Evalue: 1.20E-13, Aligned region: 645..765
ClpB_D2-small [PF10431], Evalue: 1.90E-11, Aligned region: 807..883
AAA_16 [PF13191], Evalue: 1.20E-08, Aligned region: 198..237
AAA_16 [PF13191], Evalue: 1.20E-08, Aligned region: 263..298
AAA_16 [PF13191], Evalue: 1.20E-08, Aligned region: 421..495
AAA_16 [PF13191], Evalue: 1.20E-08, Aligned region: 616..686
AAA_16 [PF13191], Evalue: 1.20E-08, Aligned region: 711..739
AAA_22 [PF13401], Evalue: 3.40E-07, Aligned region: 219..305
AAA_22 [PF13401], Evalue: 3.40E-07, Aligned region: 398..398
AAA_22 [PF13401], Evalue: 3.40E-07, Aligned region: 644..679
AAA_25 [PF13481], Evalue: 3.20E-05, Aligned region: 220..244
AAA_25 [PF13481], Evalue: 3.20E-05, Aligned region: 640..674
AAA_25 [PF13481], Evalue: 3.20E-05, Aligned region: 772..837
AAA_29 [PF13555], Evalue: 0.00015, Aligned region: 213..238
AAA_29 [PF13555], Evalue: 0.00015, Aligned region: 643..670
AAA_14 [PF13173], Evalue: 0.00015, Aligned region: 220..319
AAA_14 [PF13173], Evalue: 0.00015, Aligned region: 645..735
AAA_19 [PF13245], Evalue: 0.00017, Aligned region: 38..71
AAA_19 [PF13245], Evalue: 0.00017, Aligned region: 217..241
AAA_19 [PF13245], Evalue: 0.00017, Aligned region: 639..667
NACHT [PF05729], Evalue: 0.00022, Aligned region: 220..247
NACHT [PF05729], Evalue: 0.00022, Aligned region: 448..479
NACHT [PF05729], Evalue: 0.00022, Aligned region: 646..674
DUF258 [PF03193], Evalue: 0.00066, Aligned region: 215..237
DUF258 [PF03193], Evalue: 0.00066, Aligned region: 646..664
Clp_N [PF02861], Evalue: 0.0013, Aligned region: 24..71
Clp_N [PF02861], Evalue: 0.0013, Aligned region: 106..123
AAA_18 [PF13238], Evalue: 0.0074, Aligned region: 221..240
AAA_18 [PF13238], Evalue: 0.0074, Aligned region: 646..680
Protein Sequence: 920 a.a.     [Download]
>gi|222155042|ref|YP_002555181.1| hypothetical protein LF82_018 [Escherichia coli LF82]
MIQIDLATLVKRLNPFAKQALEMAASECMSQQASEITVAHVLLQMLAIPRNDVRVIAERTGISAEDLRQA
LTVESYPGGRSAEGYPSFSPMLIEWLKESWLLASAQMQHSELRSGVLLLTLLHSPLRYIPPAAARLLTAI
NRDQLQQDFAAWTKESAESVDLAGGQTPRATETGDTLLARYAKNMTADARNGRLDPVLCRDYEIDLMIDI
LCRRRKNNPVVVGDAGVGKSALIEGLALRIVAGQVPDKLKNTDIMTLDLGALQAGASVKGEFEKRFKGLM
AEVIFSPVPVILFIDEAHTLIGAGNQQGGLDISNLLKPALARGELKTIAATTWSEYKKYFEKDAALSRRF
QLVKVSEPNAAEATIILRGLLAVYEQSHGVLIDDDALQAAATLSERYLSGRQLPDKAIDVLDTACARVAI
NLSSPPKQISALTTLSHQQEAEIRQLERELRIGLRTDTSRMTEVLEQYDETLSALDELEVAWQQQQTLVQ
EIIALRQQLLGVAEDDVASLPDADAVEDTPPEAEQDSTDAESADDAGSVQPEETAETVSPVQRLAQLTAE
LDALHNDQLLVSPHVDKKQIAAVIAEWTGVPLNRLSQNEMSVITDLPVWLGGTIKGQDLAIASLHKHLLT
ARADLRRPGRPLGAFLLAGPSGVGKTETVLQLAELLYGGRQYLTTINMSEFQEKHTVSRLIGSPPGYVGY
GEGGVLTEAIRQKPYSVVLLDEVEKAHPDVLNLFYQAFDKGEMADGEGRLIDCKNIVFFLTSNLGYQVIV
EHADDPETMQEALYPVLADFFKPALLARMEVVPYLPLSKETLATIIAGKLARLDNVLRSRFGADVIIGPE
VTDEIMSRVTRAENGARMLESVIDGDMLPPLSLLLLQKMAANTAIARIRLSAADGAFTADVEDALPDDAV
TPQTEDETVL
 
Nucleotide Sequence: 2763 bp     [Download]
>gi|222154829|ref|NC_011993.1|:c252756-249994 Escherichia coli LF82, complete genome
ATGATCCAGATTGATTTAGCCACGCTCGTAAAGCGGCTTAACCCCTTTGCAAAACAGGCGCTGGAAATGG
CTGCCTCGGAGTGTATGAGCCAGCAGGCCAGTGAGATCACCGTTGCCCATGTGCTGTTACAGATGCTGGC
AATCCCGCGCAACGACGTAAGGGTGATTGCCGAACGCACAGGCATCAGTGCGGAGGATTTACGCCAGGCG
CTGACCGTGGAGAGTTATCCCGGTGGACGTTCCGCCGAAGGCTATCCCAGCTTCTCCCCGATGCTGATCG
AATGGCTCAAGGAGTCATGGCTGCTGGCCTCAGCCCAGATGCAGCACAGCGAACTGCGCAGCGGCGTCCT
GCTGCTTACTCTGCTGCATTCACCGCTGCGCTATATTCCACCCGCTGCTGCCCGTCTGCTGACGGCCATA
AACCGCGACCAGTTACAGCAGGATTTCGCAGCATGGACAAAAGAATCCGCCGAATCCGTGGATCTGGCTG
GCGGGCAAACGCCCCGGGCAACGGAAACCGGCGACACCCTGCTTGCCCGCTACGCCAAAAACATGACCGC
AGACGCCCGTAACGGCAGGCTTGACCCGGTACTGTGCCGCGACTATGAAATCGACCTGATGATCGACATT
CTCTGCCGCCGCCGTAAAAACAATCCGGTGGTAGTGGGCGACGCAGGCGTGGGTAAAAGCGCGCTGATTG
AAGGGCTGGCGCTGCGCATCGTGGCAGGCCAGGTGCCGGACAAGCTGAAAAACACCGATATCATGACCCT
TGACCTGGGCGCATTGCAGGCCGGTGCGTCGGTGAAAGGTGAGTTTGAAAAACGCTTCAAGGGGCTGATG
GCGGAGGTCATTTTCTCCCCGGTGCCGGTCATTCTGTTTATCGACGAAGCACATACCCTGATTGGCGCGG
GCAACCAGCAGGGCGGGCTGGATATATCCAACCTGCTCAAACCAGCGCTGGCGCGCGGCGAGCTGAAAAC
CATCGCCGCCACCACCTGGAGCGAGTACAAAAAATATTTCGAGAAAGATGCAGCTTTGTCGCGCCGCTTC
CAGTTAGTGAAGGTCAGCGAACCCAACGCTGCCGAAGCCACCATTATTCTGCGCGGTTTGTTGGCGGTCT
ATGAACAGTCTCACGGCGTGCTGATTGATGATGACGCCTTGCAGGCCGCTGCGACACTGAGCGAGCGTTA
TCTCTCCGGGCGTCAGTTGCCGGACAAAGCCATTGATGTGCTGGACACCGCCTGCGCCCGTGTGGCCATC
AACCTGTCATCGCCGCCAAAACAAATCTCGGCACTGACCACCCTGAGCCACCAGCAGGAGGCAGAAATTC
GCCAGCTTGAGCGCGAGCTTCGCATCGGGCTGCGTACCGACACCTCACGAATGACTGAGGTGTTGGAGCA
GTATGATGAAACGCTGTCGGCGCTGGACGAACTGGAAGTCGCCTGGCAGCAGCAGCAGACGCTGGTACAG
GAAATTATCGCGCTGCGCCAGCAGTTACTGGGCGTGGCAGAAGACGACGTTGCGTCGTTGCCGGACGCAG
ATGCCGTGGAGGATACGCCGCCAGAGGCAGAACAGGATAGTACCGATGCCGAATCGGCTGATGATGCAGG
CAGCGTACAGCCGGAAGAGACCGCTGAAACAGTTTCCCCGGTACAACGGCTGGCACAACTCACTGCCGAA
CTGGACGCCCTGCATAACGACCAGTTGCTGGTTTCCCCGCATGTCGATAAAAAACAGATTGCAGCGGTGA
TTGCCGAATGGACCGGCGTGCCACTTAACCGCCTGTCACAGAATGAGATGTCGGTCATCACCGACCTGCC
GGTATGGCTCGGCGGCACCATCAAAGGCCAGGACCTGGCGATTGCCAGCCTGCATAAACACCTGCTGACC
GCACGCGCCGACCTGCGCCGTCCGGGACGCCCGCTTGGTGCGTTCCTGCTGGCTGGCCCCAGCGGCGTGG
GTAAAACCGAAACCGTCCTGCAACTGGCGGAACTGCTCTATGGCGGACGTCAATACCTGACCACCATCAA
TATGTCTGAGTTCCAGGAGAAACACACCGTTTCGCGGCTGATTGGCTCTCCTCCGGGTTATGTCGGCTAC
GGTGAAGGCGGCGTACTGACCGAAGCGATTCGCCAGAAACCGTACTCGGTGGTGCTGCTCGATGAAGTAG
AAAAAGCGCACCCGGATGTACTCAACCTGTTCTACCAGGCGTTTGACAAGGGCGAGATGGCAGACGGTGA
AGGCCGCCTGATTGACTGTAAAAATATCGTTTTCTTCCTGACCTCCAACCTTGGCTACCAGGTGATTGTC
GAACACGCCGATGACCCGGAAACCATGCAGGAAGCCCTCTATCCGGTGCTGGCGGACTTCTTTAAACCTG
CTCTGCTGGCGCGCATGGAAGTGGTGCCTTACCTACCGCTGTCGAAAGAGACGCTCGCTACCATTATTGC
CGGGAAACTGGCCCGCCTGGATAACGTGCTGCGCAGCCGCTTTGGCGCGGACGTGATTATTGGGCCGGAA
GTGACGGACGAAATCATGAGCCGCGTCACCCGCGCGGAAAACGGCGCGAGGATGCTGGAATCGGTTATCG
ACGGCGACATGCTGCCGCCGCTCTCGCTGCTGCTGTTGCAGAAAATGGCGGCCAACACGGCGATTGCCCG
GATTCGCCTGTCGGCGGCAGACGGTGCGTTCACGGCAGATGTGGAAGATGCGCTGCCTGATGATGCCGTG
ACACCGCAAACAGAGGATGAAACGGTTTTATGA
 Primer design