SecReT6
Protein ID: 222155046
SecReT6 ID795
T6SS typei1
Gene symbol-
Locus tagLF82_022
StrainEscherichia coli LF82
Repliconchromosome [GenBank: NC_011993] [Browse all T6SS(s) in this replicon]
Location [Strand]255405..256697 [-]
Producthypothetical protein
NoteFha
UniProt IDE2QG01
KEGG IDelf:LF82_022
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 0.00097, Aligned region: 44..108
Protein Sequence: 430 a.a.     [Download]
>gi|222155046|ref|YP_002555185.1| hypothetical protein LF82_022 [Escherichia coli LF82]
MEPLMAEEKQQSRQASLTLQVMNGNELESGRAAKCLFSENGGDIGHTPECHWQVQDRAGSIAARACTVIR
HDGAYCLRCLTPGLMINLAPASSDALIRLRQGDEIQLGALALKVFLHDGAAVTYDERMATPETIVMNRDS
LADTLLTTEGQPAYPGMPFQHQLAPTVAHGFSSDPLQALQTESLMVADDPIAPRVSRPVAPASDLTGANG
INTPFMDLPPGNARHEDGDEFSAMAQYHLAVTPLLRGMECPLTLHNSQDADEFLEEAGRALQAAIKGLLS
LQQQQNSLSDKHLRPLEDNPLRLDMDYATALNVMFAEGKSPVHLAAPAAIAESLRNIRHHEEANRAAIVE
ALRVMLDAFSPGNLMRRFAQYRRSHELRQKMDNAWAWQMYSNYYDELASSRQQGFEMLFNEVYAQVYDRV
LREKQREPEA
 
Nucleotide Sequence: 1293 bp     [Download]
>gi|222154829|ref|NC_011993.1|:c256697-255405 Escherichia coli LF82, complete genome
ATGGAACCACTTATGGCTGAGGAAAAACAGCAATCCCGCCAGGCCTCACTGACTTTACAGGTGATGAATG
GCAACGAACTGGAAAGCGGACGCGCCGCAAAATGCCTGTTCAGCGAAAACGGCGGTGATATTGGCCATAC
GCCGGAATGTCACTGGCAGGTACAGGACCGGGCGGGAAGCATTGCTGCGCGTGCCTGTACCGTTATCCGG
CACGACGGAGCCTATTGCCTGCGGTGCCTGACGCCGGGACTGATGATTAATCTGGCCCCGGCCTCTTCCG
ATGCGCTCATCCGCCTGCGCCAGGGGGATGAGATCCAGCTCGGCGCACTGGCGCTGAAAGTGTTTCTGCA
TGACGGTGCAGCTGTTACCTATGACGAGCGGATGGCGACCCCGGAAACGATTGTAATGAACCGCGACAGT
CTGGCGGACACCCTGCTGACCACCGAGGGACAACCGGCGTATCCGGGAATGCCGTTCCAGCATCAGCTTG
CCCCCACGGTGGCGCACGGTTTTTCCAGCGATCCGCTCCAGGCACTCCAGACGGAAAGCCTGATGGTGGC
AGATGATCCGATCGCCCCACGCGTTTCCCGGCCCGTTGCCCCCGCCTCCGATCTGACAGGTGCAAACGGG
ATCAACACGCCGTTTATGGATCTGCCACCCGGCAATGCCCGTCATGAGGACGGCGATGAATTTTCTGCCA
TGGCGCAGTACCACCTGGCCGTAACCCCGCTGCTGCGCGGTATGGAGTGTCCGCTGACGCTGCACAATTC
TCAGGATGCGGATGAGTTTCTCGAAGAGGCCGGACGGGCGTTGCAGGCCGCCATTAAGGGATTGCTGAGT
CTGCAACAACAACAGAATAGCCTGTCGGATAAACACCTGCGTCCACTGGAAGACAACCCGTTGCGCCTTG
ATATGGACTATGCCACCGCGCTGAACGTCATGTTCGCCGAGGGTAAAAGCCCGGTACATCTCGCAGCACC
TGCGGCCATCGCCGAAAGCCTGCGCAACATCCGGCATCATGAAGAGGCCAACCGGGCGGCGATTGTGGAA
GCGTTGCGTGTCATGCTGGACGCCTTCTCGCCGGGCAACCTGATGCGCCGCTTTGCGCAATACCGCCGCA
GCCATGAGCTGCGCCAGAAAATGGACAACGCCTGGGCATGGCAGATGTACAGCAACTATTACGATGAACT
GGCCTCCAGCCGACAGCAGGGATTTGAAATGCTGTTCAATGAAGTTTATGCCCAGGTCTATGACCGGGTG
CTGCGCGAAAAACAGCGGGAGCCGGAAGCATGA
 Primer design