SecReT6
Protein ID: 222155048
SecReT6 ID795
T6SS typei1
Gene symbol-
Locus tagLF82_024
StrainEscherichia coli LF82
Repliconchromosome [GenBank: NC_011993] [Browse all T6SS(s) in this replicon]
Location [Strand]257715..259556 [-]
Producthypothetical protein
NoteTssF
UniProt IDE2QG03
KEGG IDelf:LF82_024
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 8.90E-190, Aligned region: 5..613
Protein Sequence: 613 a.a.     [Download]
>gi|222155048|ref|YP_002555187.1| hypothetical protein LF82_024 [Escherichia coli LF82]
MAFEERYYREELDYLRQLGKLLAQEKPHLAHFLAEKEGDPDVERLMEAFAFMSGSLRQKLEDEFPEFTHG
LIRMLWANYLRPVPAMTVIAYEPKTDQLKVPVQVCRNELIRSRSEKSSLTAQKVLPDNHDKIVSSVACHF
TLARDIWLQPLRILDTRNASSLKEGIIDISFTADNNVSPAMLDLNKITFWLGNEDDYTRHQLYLWFCECL
MDAELIAGEHSLPLPDLWLDAAGFDNQDALLPWPKNVHSGYRVLQEYFCYPEAFFFFHLRDVAPLPDDFP
VSAFTLRLHFNRPLPADIKLRQDSLRLHCTPAINLFTHYAEPVRPDGRMAEYPLRASHKHPDAYDIFQVS
TVTSKIKVSGTDSSPGSQVRVWPEFESFQHQMEYSRQREVVYWHHRTKTSLFHYGLEHSIAFVHADGSIP
GSSRFNDDVITTSLICTNRMIPARLHTGDICVAVNKNPAVASFRNVTRPTQPLWPVTDGDMHWSLISAMN
LNYLSLLDRETLIQILRTFDLPGAHHPQRARLSRQKLDAIEKLETKPVDRLFKGVPVRGLATTLWIRPDP
FICEGEIYLLGTVLSHFFALYASINSYHCLKIINTESQEAWEWQEKMGQHALI
 
Nucleotide Sequence: 1842 bp     [Download]
>gi|222154829|ref|NC_011993.1|:c259556-257715 Escherichia coli LF82, complete genome
GTGGCTTTTGAAGAACGTTACTACCGCGAAGAACTGGATTATCTGCGCCAGCTTGGCAAACTGTTGGCGC
AGGAAAAACCGCATCTGGCCCATTTTCTGGCCGAGAAAGAGGGTGATCCGGACGTGGAGCGTCTGATGGA
AGCCTTTGCCTTTATGTCCGGTAGCCTGCGCCAGAAACTTGAGGACGAATTCCCCGAATTCACCCATGGG
CTAATCCGTATGCTGTGGGCAAACTATTTACGCCCGGTTCCGGCCATGACGGTTATTGCCTATGAACCCA
AAACCGATCAGTTAAAAGTCCCTGTTCAGGTCTGTCGTAATGAACTGATCAGAAGCCGCTCAGAAAAGTC
CTCCCTGACTGCTCAGAAGGTGCTGCCTGACAATCATGATAAAATCGTTTCTTCCGTAGCCTGCCATTTC
ACGCTGGCGCGCGATATCTGGCTGCAACCACTGCGCATTCTCGATACCCGCAACGCCAGCAGTCTGAAAG
AAGGCATCATAGATATCAGTTTTACCGCAGATAACAATGTCTCCCCCGCCATGCTTGACCTGAACAAAAT
CACGTTCTGGCTGGGTAATGAAGACGATTATACCCGACACCAGCTTTATCTGTGGTTTTGCGAATGCCTG
ATGGATGCGGAACTGATTGCCGGAGAGCACAGCCTGCCGCTGCCGGATCTGTGGCTGGATGCTGCGGGTT
TTGACAACCAGGATGCCCTGCTGCCGTGGCCGAAAAATGTCCACAGCGGCTACCGCGTGCTTCAGGAGTA
TTTCTGCTATCCCGAAGCCTTCTTCTTTTTCCATCTGCGCGATGTTGCGCCGCTACCAGACGATTTCCCG
GTGAGTGCGTTTACGCTGCGCCTGCACTTTAACCGCCCGTTACCTGCCGACATCAAGCTGCGCCAGGATT
CGCTGCGTCTGCACTGTACGCCAGCCATTAACCTGTTTACGCATTATGCGGAACCCGTCAGGCCGGATGG
GCGGATGGCGGAATACCCGCTGCGCGCCAGCCATAAGCATCCGGACGCCTATGACATTTTTCAGGTCAGT
ACAGTCACCAGTAAAATCAAAGTGTCAGGGACTGATTCCAGCCCCGGCAGCCAGGTGCGTGTCTGGCCCG
AATTTGAAAGTTTCCAGCACCAGATGGAGTACAGCCGCCAGCGGGAAGTCGTCTACTGGCATCACCGGAC
TAAAACGTCCCTGTTTCACTACGGGCTTGAACATAGTATCGCCTTTGTCCATGCAGACGGTAGCATTCCG
GGCAGCTCACGGTTTAACGATGACGTGATCACCACGTCATTAATCTGTACCAACCGTATGATCCCTGCCC
GGCTGCATACCGGTGATATCTGCGTGGCCGTCAACAAAAATCCGGCAGTGGCCTCATTTCGTAATGTCAC
GCGCCCGACACAGCCGCTCTGGCCAGTCACGGACGGCGACATGCACTGGTCGCTGATTTCCGCGATGAAC
CTGAACTACCTCTCCCTGCTGGACAGGGAGACACTGATCCAGATCCTGCGGACCTTCGACCTGCCAGGCG
CTCACCATCCGCAGCGGGCCAGACTGTCACGCCAGAAACTGGATGCCATAGAAAAACTCGAAACCAAACC
TGTTGACAGGTTGTTTAAAGGCGTACCGGTTCGCGGGCTGGCGACCACGCTGTGGATACGTCCCGATCCG
TTTATCTGCGAAGGTGAAATTTATCTTCTGGGTACCGTGCTCTCGCACTTCTTTGCCCTCTACGCCAGCA
TCAATTCGTACCACTGTCTGAAAATCATTAACACGGAAAGTCAGGAGGCTTGGGAATGGCAGGAGAAAAT
GGGCCAGCACGCCCTGATATAG
 Primer design