SecReT6
Protein ID: 222155049
SecReT6 ID795
T6SS typei1
Gene symbol-
Locus tagLF82_025
StrainEscherichia coli LF82
Repliconchromosome [GenBank: NC_011993] [Browse all T6SS(s) in this replicon]
Location [Strand]259562..259987 [-]
Producthypothetical protein
NoteTssE
UniProt IDE2QG04
KEGG IDelf:LF82_025
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 4.90E-21, Aligned region: 30..123
Protein Sequence: 141 a.a.     [Download]
>gi|222155049|ref|YP_002555188.1| hypothetical protein LF82_025 [Escherichia coli LF82]
MQRRDSGPTGSLFERIREAANPPSYQNPKEALIRSIRRNLRQVLNTRSGSCYGSPELGITDLNDESLASS
DFRREIRKSISQCILHYEPRITDVVVTAAAPDEYAPVELRFHIVATIDVSKTKGVFEFDILLDNHQRYCV
E
 
Nucleotide Sequence: 426 bp     [Download]
>gi|222154829|ref|NC_011993.1|:c259987-259562 Escherichia coli LF82, complete genome
ATGCAAAGACGGGATTCAGGACCAACCGGCAGTCTTTTTGAACGTATCCGTGAGGCGGCAAATCCGCCTT
CATATCAGAATCCAAAAGAAGCACTGATACGTTCCATCAGACGTAACCTGCGACAGGTCCTGAATACCCG
CTCCGGCAGTTGTTATGGCTCACCGGAGCTGGGGATTACTGATTTAAATGATGAATCGCTGGCCTCCAGC
GATTTCAGACGAGAAATCCGTAAGTCCATTAGCCAGTGCATTTTACATTACGAACCTCGTATTACCGATG
TTGTTGTTACGGCTGCGGCACCGGATGAATACGCCCCTGTGGAACTGCGTTTTCATATTGTGGCTACGAT
CGATGTCAGCAAGACCAAGGGAGTGTTTGAATTTGACATTTTGCTGGACAACCATCAACGCTATTGTGTG
GAGTGA
 Primer design