SecReT6
Protein ID: 222155052
SecReT6 ID795
T6SS typei1
Gene symbol-
Locus tagLF82_028
StrainEscherichia coli LF82
Repliconchromosome [GenBank: NC_011993] [Browse all T6SS(s) in this replicon]
Location [Strand]262708..263226 [+]
Producthypothetical protein
NoteTssD
UniProt IDQ6TKV2
KEGG IDelf:LF82_028
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 8.30E-36, Aligned region: 6..155
DCAF15_WD40 [PF14939], Evalue: 0.0034, Aligned region: 93..137
Protein Sequence: 172 a.a.     [Download]
>gi|222155052|ref|YP_002555191.1| hypothetical protein LF82_028 [Escherichia coli LF82]
MPTPCYISITGQTQGNITAGAFTADSVGNIYVQGHEDEMLVQEFLHNVTVPTDPQSGQPSGQRAHKPFIF
TVALNKAVPLLYNALASGEMLPKVELHWWRTSVEGKQEHYFTTRLTDATIVDMNLHMPHCQDPAQREFTQ
LLAVSLAYRKVEWEHIKSGTSGADDWRAPLEA
 
Nucleotide Sequence: 519 bp     [Download]
>gi|222154829|ref|NC_011993.1|:262708-263226 Escherichia coli LF82, complete genome
ATGCCAACCCCATGTTACATTTCAATTACAGGTCAGACCCAGGGGAACATCACTGCCGGTGCTTTCACCG
CAGATTCTGTCGGCAATATCTACGTGCAGGGACACGAAGATGAAATGCTGGTGCAGGAGTTTCTGCATAA
CGTTACTGTTCCAACCGATCCGCAGTCTGGTCAGCCTTCCGGGCAGCGTGCTCACAAACCGTTCATTTTC
ACCGTGGCGCTGAACAAAGCCGTTCCGCTGCTGTACAACGCGCTGGCCTCCGGTGAAATGCTGCCGAAAG
TGGAGCTGCACTGGTGGCGTACCTCTGTTGAAGGCAAGCAGGAGCACTACTTCACCACACGTCTTACTGA
CGCGACGATTGTGGACATGAACCTGCATATGCCGCACTGCCAGGACCCTGCACAGCGTGAGTTTACGCAA
TTGCTCGCAGTATCACTGGCCTACCGTAAGGTTGAGTGGGAGCACATCAAATCCGGTACTTCTGGTGCCG
ATGACTGGCGTGCACCGCTGGAAGCATAA
 Primer design