SecReT6
Protein ID: 222155056
SecReT6 ID795
T6SS typei1
Gene symbol-
Locus tagLF82_032
StrainEscherichia coli LF82
Repliconchromosome [GenBank: NC_011993] [Browse all T6SS(s) in this replicon]
Location [Strand]268098..268748 [+]
Productreceptor protein
NotePAAR
UniProt IDE2QG11
KEGG IDelf:LF82_032
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 4.40E-21, Aligned region: 143..210
DDE_Tnp_1 [PF01609], Evalue: 4.90E-16, Aligned region: 9..140
DUF4150 [PF13665], Evalue: 8.40E-05, Aligned region: 143..166
DUF4150 [PF13665], Evalue: 8.40E-05, Aligned region: 179..200
Protein Sequence: 216 a.a.     [Download]
>gi|222155056|ref|YP_002555195.1| receptor protein [Escherichia coli LF82]
MRDCHSSDDKDVIAIDGKTLRHSYDKSRHIISAFSTMHSLVLGKIRTDEKSNEITAIPELLNILDIKGKI
ITTDAMGGQKDIADKIQKQGGDYLFAVKGNQERLNKAFEEKFPLKELNNPEHDSYAMSEKSHGTRHDGYY
ETAITAGSSTVFIDGLPAARQGDPLTPHDKPKHPPHPRKIARGSSTVFIDGLPAARTGDAIDCGGVVIGG
GTVNIG
 
Nucleotide Sequence: 651 bp     [Download]
>gi|222154829|ref|NC_011993.1|:268098-268748 Escherichia coli LF82, complete genome
ATGCGTGACTGCCATTCTTCAGATGATAAAGACGTCATCGCAATTGATGGAAAAACGCTCCGGCATTCTT
ATGACAAGAGTCGTCATATCATTAGTGCGTTCTCAACTATGCACAGTCTGGTCCTTGGCAAAATCAGGAC
GGATGAGAAATCCAATGAGATCACAGCTATCCCTGAACTTCTTAACATCTTGGATATTAAAGGAAAAATT
ATCACAACTGATGCGATGGGTGGCCAGAAAGATATTGCAGATAAGATACAAAAACAGGGCGGTGATTATT
TATTCGCTGTAAAAGGAAACCAGGAGCGGCTAAATAAAGCCTTTGAGGAAAAATTTCCGCTGAAAGAATT
AAATAACCCAGAGCATGACAGTTACGCAATGAGTGAAAAGAGTCACGGTACCCGGCATGACGGTTATTAT
GAGACCGCCATCACCGCCGGGTCATCCACCGTTTTTATCGATGGTCTCCCCGCAGCCCGTCAGGGAGATC
CGCTGACGCCGCATGATAAACCGAAGCATCCACCTCATCCCCGAAAAATCGCCAGAGGCTCTTCAACCGT
CTTTATTGACGGCCTGCCCGCCGCCAGAACCGGTGATGCTATTGACTGCGGCGGCGTGGTTATTGGTGGC
GGTACGGTAAATATAGGCTGA
 Primer design