SecReT6
Protein ID: 222155059
SecReT6 ID795
T6SS typei1
Gene symbol-
Locus tagLF82_035
StrainEscherichia coli LF82
Repliconchromosome [GenBank: NC_011993] [Browse all T6SS(s) in this replicon]
Location [Strand]271895..273334 [+]
Producthypothetical protein
NotePAAR
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF4150 [PF13665], Evalue: 1.60E-23, Aligned region: 14..116
Peptidase_C39 [PF03412], Evalue: 4.90E-07, Aligned region: 352..474
PAAR_motif [PF05488], Evalue: 6.50E-05, Aligned region: 78..106
Peptidase_C39_2 [PF13529], Evalue: 0.00025, Aligned region: 354..391
Peptidase_C39_2 [PF13529], Evalue: 0.00025, Aligned region: 431..455
Protein Sequence: 479 a.a.     [Download]
>gi|222155059|ref|YP_002555198.1| hypothetical protein LF82_035 [Escherichia coli LF82]
MGNYHIGDGECRFRVVCSSPDVCEVGGYKVPFDSYQTLDSERQYSSTVWARGCRALNVGSVIAGTQSNAG
KGVISGTSQGTGDCVILTGSPTVTIEGKPVAYHGSVVGINNHNCLGKLYTKIKSPMISVIDRTFNYERTA
EVIHDLLLLKDLLSVGNIFDGDISPEVKNDLFQIKDPDQSWGEFFSIKNIRESLRNGIEGDKSQIREWFG
ENTLTQMGNGAITTLHGVADLALVTFDALLDTATATVACPIGEDGLCEQANINLNEKEQALFNISNSLIN
GQAWDALKKMIMDTNNGDQIALEHFASFLWGFMIPAKIPEENISGKVFVEPVVLEGGAGGNWTVFDEVLD
SNVIKQLTLTGCGAACGEMLLRDRYIFVTQNVIGTELTSMTSLANKLNKFDVGWEGNAVSESSLYALSNT
GSWGAMMWDSGSKVGHWVLVKGVDDAGNVIIYDPYQGSRYLMTEQEFKEVWNGHSVYKP
 
Nucleotide Sequence: 1440 bp     [Download]
>gi|222154829|ref|NC_011993.1|:271895-273334 Escherichia coli LF82, complete genome
ATGGGTAACTATCATATCGGGGATGGTGAATGTAGATTTAGAGTCGTGTGTTCTTCACCAGATGTATGTG
AAGTAGGAGGTTACAAGGTTCCTTTTGACAGTTACCAGACTTTAGATAGTGAAAGACAGTACAGTTCAAC
GGTATGGGCGCGTGGATGCAGAGCTTTAAATGTTGGTTCAGTGATTGCTGGAACTCAAAGTAATGCCGGT
AAAGGTGTCATATCCGGTACATCTCAAGGAACGGGTGACTGTGTTATTTTAACGGGAAGTCCGACTGTAA
CAATAGAAGGGAAACCTGTTGCTTATCATGGTTCAGTTGTTGGGATTAATAACCACAACTGCCTTGGTAA
ATTGTATACCAAAATAAAATCACCAATGATTTCTGTCATTGATAGAACTTTTAATTATGAAAGGACTGCT
GAAGTAATACACGATTTACTGCTTCTGAAGGATCTCCTCTCTGTTGGTAATATTTTTGACGGAGATATTT
CACCTGAGGTTAAAAATGATTTATTTCAAATAAAAGATCCTGACCAATCATGGGGGGAGTTTTTTTCAAT
AAAGAATATCAGAGAATCTCTCAGGAATGGTATTGAAGGAGATAAATCTCAGATCAGAGAATGGTTTGGA
GAGAACACACTTACTCAAATGGGGAATGGAGCAATCACCACTTTACATGGTGTGGCGGATTTAGCCTTAG
TTACATTCGATGCTCTGTTAGATACGGCAACGGCAACGGTTGCTTGCCCGATAGGCGAAGATGGGTTATG
TGAACAGGCAAATATAAATTTAAATGAAAAAGAACAGGCTTTATTTAATATTAGTAATTCATTGATAAAT
GGGCAAGCATGGGATGCACTTAAAAAAATGATAATGGATACAAATAATGGTGATCAGATTGCTCTGGAGC
ATTTTGCCAGCTTTTTATGGGGCTTTATGATACCCGCAAAAATACCAGAAGAAAATATCTCTGGGAAAGT
ATTTGTAGAGCCAGTAGTTTTAGAAGGTGGTGCTGGTGGCAATTGGACAGTATTTGATGAGGTTTTAGAT
TCAAATGTAATAAAGCAATTGACTTTAACAGGCTGTGGAGCGGCCTGTGGGGAAATGTTGCTTAGGGATA
GGTATATTTTTGTCACGCAAAATGTAATTGGAACAGAATTAACATCTATGACGTCGCTGGCAAACAAGCT
TAATAAATTTGATGTCGGCTGGGAAGGGAATGCAGTGAGCGAATCTAGTTTATATGCCCTCAGTAATACT
GGTTCATGGGGAGCAATGATGTGGGATTCTGGAAGTAAAGTAGGGCATTGGGTACTTGTTAAGGGTGTTG
ATGATGCTGGGAATGTGATAATATATGATCCATATCAAGGGAGTCGATATCTGATGACTGAACAGGAATT
TAAGGAGGTATGGAATGGGCATAGTGTTTACAAACCATAA
 Primer design