SecReT6
Protein ID: 222157512
SecReT6 ID796
T6SS typei2
Gene symbol-
Locus tagLF82_438
StrainEscherichia coli LF82
Repliconchromosome [GenBank: NC_011993] [Browse all T6SS(s) in this replicon]
Location [Strand]2942572..2945910 [+]
Producthypothetical protein
NoteTssM
UniProt IDE2QQS2
KEGG IDelf:LF82_438
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 9.10E-66, Aligned region: 396..713
IcmF-related [PF06761], Evalue: 9.10E-66, Aligned region: 776..815
DUF1215 [PF06744], Evalue: 2.50E-34, Aligned region: 430..463
DUF1215 [PF06744], Evalue: 2.50E-34, Aligned region: 835..954
Protein Sequence: 1112 a.a.     [Download]
>gi|222157512|ref|YP_002557651.1| hypothetical protein LF82_438 [Escherichia coli LF82]
MKRVVRLLGVGLLLLVVLLLILFVLAQTTPLISAQDEHAVWLRLLITAIVICLLSMCIFFLFSFRQNEAS
TISLYAQPTDIKEINTEQPNYASLLTIYLRDRYGPFWRRKVRLLLVTGEPEQAEAIAPGLTGQHWLEGDH
TVLIYGGRPTAEPDVTLLTALKKLRRSRPLDGIIWALTEEQSRQTAQLDKGWRGLINGGKRLGFQAPLYL
WQVCDDGDYQTGRPLQSVGCLLPERCTPEQLAVMLEAQTLPLTEQGMSQLLTDNRHDFLLRLAHTLAERG
IAHWQTVLKPLLAGGAFSSLRLRGLMFSPPLAAVPESAPHAWLPSPVWAGVTGDNARGRTVGFPWLRASL
ITGICMLAIWGAGMTTSFFANRALVQETGIQTARALDTRLPLAEQLVALHTLQGELERLQYRIREGAPWY
QRFGLERNQQLLAAAFPGYAQAANRLVSDVAVDHLQQQLSAFVALPPNSPQRTATGEQRYKQLKALLMTA
HPEKADAAFFSTTLMADGLRYENIPEGVRQNVLPSLLTFWMANLPEHPQWETSPPPELTGAVRKILLRQI
GVRNAENTLYQNVLQQVSRNYADMTLADMTGDTLTESLFSTEQTVPGMFTRQAWEGQVREAIEQVVTARR
EEIDWVLSDRQQDTSADISPDTLRNRLTSRYFTDFAGSWLAFLNSIRWKKEDSLSGILDQLTLMADARQS
PLIALTDTLAWQAAAGRENRGLSDSLAKSAQELFNGKEKTPQQSREGDDVPVGPLDKTFAPLLRLLGDKA
GGGDSQLSLQTYLTRVTRVRLKLQQVTNAPDPQEMTQQLAQTVLQGKTVDLTDTRDYGRLIAASLGEEWS
GFGQALFVRPVEQSWRQVLTPAADSLNRQWQRAIVSHWNQDFAGRYPFKASQNDASLPLLAQYLRDDGRI
NLFIAANLSGVLKREGRYWVADAMNTQGLTVNPDFIRALNRLRDVADTAFASGDAGIHFELRAKPARDVM
KTHLVIDGQELEYFNQKERWQRFNWPDEQWQPGASLSWTSTQAMERILADYRGSWSLIRLLEQAQVTPVD
SSTFKVVWKAQDGLPLNYLLRVEQGKGPLALLELKNFRLPGQVFLTGRSMKDAEEYGEDADE
 
Nucleotide Sequence: 3339 bp     [Download]
>gi|222154829|ref|NC_011993.1|:2942572-2945910 Escherichia coli LF82, complete genome
ATGAAAAGAGTTGTGCGTCTTTTGGGTGTGGGGTTACTGCTCCTTGTTGTGTTGTTGCTCATTTTGTTTG
TTCTGGCTCAGACCACACCGCTGATATCAGCACAGGATGAGCATGCTGTCTGGCTTCGTCTGTTGATAAC
AGCGATTGTGATCTGTTTGCTAAGTATGTGCATATTTTTCCTCTTTTCTTTCCGGCAGAACGAAGCCTCG
ACGATATCACTATACGCTCAACCGACTGATATAAAGGAAATAAATACGGAGCAGCCGAACTATGCATCAC
TGCTGACGATATATTTACGCGACCGCTACGGTCCGTTCTGGCGGCGTAAAGTCCGCCTGCTGCTGGTGAC
CGGCGAGCCTGAACAGGCAGAAGCCATCGCGCCGGGGCTGACCGGGCAACACTGGCTGGAAGGCGACCAC
ACGGTGCTGATATATGGCGGCAGGCCAACAGCGGAGCCTGATGTCACACTGCTGACCGCCTTAAAAAAAC
TGCGCCGCAGCCGTCCGCTGGACGGCATCATCTGGGCGCTGACAGAAGAACAGAGCCGCCAGACAGCGCA
ACTCGACAAAGGCTGGCGCGGACTGATAAACGGCGGTAAGCGACTCGGTTTTCAGGCTCCACTCTATTTG
TGGCAGGTCTGTGACGACGGTGATTATCAGACCGGACGCCCCCTGCAAAGCGTCGGCTGCCTGCTGCCGG
AACGCTGTACCCCGGAACAACTGGCTGTAATGCTGGAAGCACAAACCCTGCCGCTGACGGAACAGGGCAT
GTCGCAGCTACTGACCGATAACCGCCATGATTTTCTGCTGCGTCTGGCTCATACCCTTGCAGAGCGGGGT
ATTGCTCACTGGCAGACCGTCCTGAAACCGCTGCTGGCAGGCGGCGCATTTTCTTCCCTGCGCCTGCGCG
GCCTGATGTTCAGCCCGCCGCTTGCCGCCGTGCCGGAGTCCGCACCTCATGCGTGGCTGCCGTCACCGGT
CTGGGCGGGCGTCACCGGCGATAACGCGCGGGGTCGCACTGTAGGCTTTCCGTGGCTACGCGCCTCGCTG
ATAACCGGCATCTGCATGCTGGCGATATGGGGGGCCGGAATGACGACCTCGTTCTTCGCCAACCGCGCGC
TTGTTCAGGAAACCGGTATCCAGACGGCACGTGCGCTTGATACCCGCCTGCCGCTGGCAGAACAACTGGT
GGCGCTGCATACCCTGCAGGGCGAACTGGAACGCCTGCAATACCGTATCCGTGAGGGTGCGCCGTGGTAT
CAGCGTTTTGGCCTTGAACGTAACCAGCAACTGCTCGCTGCCGCTTTTCCCGGCTATGCGCAGGCGGCAA
ACCGGCTGGTGAGCGACGTGGCCGTTGACCATCTGCAACAGCAACTGAGCGCCTTTGTCGCGCTGCCGCC
CAACAGTCCTCAGCGTACCGCCACCGGCGAACAACGCTATAAGCAGCTTAAGGCATTGCTGATGACCGCT
CACCCGGAAAAGGCCGACGCTGCCTTTTTCAGTACCACGCTGATGGCAGACGGCCTGCGCTACGAGAATA
TCCCGGAAGGTGTGCGGCAGAACGTGTTGCCGTCACTGCTGACCTTCTGGATGGCGAACCTGCCGGAACA
CCCGCAGTGGGAAACCTCACCGCCACCGGAACTGACCGGCGCGGTGCGTAAAATCCTGCTGCGCCAGATT
GGTGTGCGTAATGCCGAAAACACCCTCTACCAGAACGTGCTGCAACAGGTGTCCCGCAACTACGCCGATA
TGACGCTGGCAGACATGACCGGAGATACCCTCACCGAATCTCTTTTCAGTACGGAACAGACGGTGCCGGG
GATGTTCACCCGTCAGGCGTGGGAAGGACAGGTCAGGGAAGCCATCGAGCAGGTGGTGACGGCGCGGCGC
GAGGAAATCGACTGGGTACTCAGCGACCGCCAGCAGGATACCTCTGCGGATATCTCGCCGGATACGCTGC
GTAACCGTCTCACCTCTCGCTACTTTACCGACTTCGCCGGAAGCTGGCTGGCGTTTCTCAACAGCATTCG
CTGGAAAAAGGAAGACTCACTCTCCGGCATTCTCGACCAGCTGACACTGATGGCCGATGCCCGTCAGTCG
CCGCTGATTGCGCTGACGGACACCCTCGCGTGGCAGGCGGCGGCAGGCAGGGAAAACCGTGGTCTGTCAG
ACTCGCTGGCGAAATCGGCACAGGAACTGTTTAACGGCAAGGAGAAAACGCCGCAGCAATCCCGTGAAGG
TGACGACGTGCCTGTCGGGCCGCTGGATAAAACCTTCGCGCCGCTGCTGCGGTTGCTGGGCGATAAGGCC
GGAGGCGGCGACAGCCAGCTGAGTCTACAGACCTACCTCACCCGCGTCACCCGCGTGCGTCTCAAACTGC
AACAGGTGACCAACGCCCCCGACCCGCAGGAGATGACCCAGCAACTGGCGCAGACGGTTTTACAGGGCAA
AACCGTTGACCTCACCGACACCCGCGACTACGGACGGTTAATCGCCGCCAGTCTGGGCGAGGAATGGAGT
GGCTTCGGTCAGGCGCTGTTCGTCCGCCCGGTAGAGCAGTCGTGGCGGCAGGTGCTGACGCCTGCGGCGG
ACAGCCTGAACCGCCAGTGGCAGCGGGCGATTGTCAGCCACTGGAATCAGGACTTCGCTGGCCGCTATCC
GTTCAAAGCCTCACAGAACGATGCCTCCCTCCCCCTGCTGGCGCAGTACCTGCGCGATGACGGGCGCATC
AACCTGTTTATTGCAGCCAACCTTTCCGGCGTGCTGAAACGAGAGGGCCGCTACTGGGTGGCTGACGCCA
TGAACACGCAGGGGCTGACGGTCAATCCGGACTTTATCCGCGCCCTGAACCGCCTGCGCGACGTGGCCGA
TACCGCCTTTGCCAGCGGTGATGCCGGAATACATTTTGAACTGCGGGCAAAACCGGCCCGTGACGTGATG
AAAACACATCTGGTGATTGACGGGCAGGAGCTGGAATATTTCAACCAGAAAGAACGCTGGCAGCGTTTTA
ACTGGCCGGATGAACAGTGGCAACCCGGCGCATCGCTAAGCTGGACCAGCACACAGGCGATGGAGCGCAT
ACTGGCGGATTACCGGGGAAGCTGGAGCCTTATTCGTCTGCTGGAACAGGCGCAGGTGACACCGGTCGAC
AGCAGCACCTTTAAAGTGGTGTGGAAAGCGCAGGACGGCCTGCCGCTGAATTACCTGCTGCGGGTTGAAC
AGGGCAAAGGGCCGCTGGCGCTGCTGGAGCTGAAAAACTTCCGCCTGCCGGGACAGGTGTTCCTGACCGG
CAGGAGTATGAAGGATGCGGAAGAATACGGGGAAGACGCCGATGAGTGA
 Primer design