SecReT6
Protein ID: 224582124
SecReT6 ID330
T6SS typei3
Gene symbol-
Locus tagSPC_0293
StrainSalmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594
Repliconchromosome [GenBank: NC_012125] [Browse all T6SS(s) in this replicon]
Location [Strand]318373..321999 [+]
Producthypothetical protein
NoteTssM
UniProt IDC0Q6Q2
KEGG IDsei:SPC_0293
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 3.30E-93, Aligned region: 507..835
ImcF-related_N [PF14331], Evalue: 7.90E-51, Aligned region: 263..307
ImcF-related_N [PF14331], Evalue: 7.90E-51, Aligned region: 307..460
DUF1215 [PF06744], Evalue: 1.40E-32, Aligned region: 365..401
DUF1215 [PF06744], Evalue: 1.40E-32, Aligned region: 944..1065
Protein Sequence: 1208 a.a.     [Download]
>gi|224582124|ref|YP_002635922.1| inner membrane protein [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
MQKFLSLLFSRRALAIVGVLVLALLVWFVGPLVSFDTLRPLASVGSRVVTIALLLMLLVLWLVNWSMSII
GISVLCLAIGFVTPLLALGDVHPFAPLWVRLTLIGFILLVYALYGLYRLWRALRMDEQLLRRFLHPRGEE
VPVAGEIKADLRTVNHIVTQAIRQLRQLRVDMPGWRKIFEGKRFLYELPWFMVVGSPGDGKTTALLNTGL
QFPLAEQMEQTSRILTMPGGGTLHCDWWFTNEAVLIDTAGRYARHDDGGEASAAQRNAGEWQGFLGLLRK
HRPGAPLNGVILTLNVADLTAQSPAERLTLRLDQGLDTRLQEEYDLKSRQRLYTFPREFAALGEPLLEAI
EQIFLDSKFDATQLNNTLRGVFFTSAAQAQADAVADQLSIWQRFVRAIKTARGESSASLPHALPDGNRSY
FLHDLLTQFIFREAHLVEPNLQWAWCYRLLRLGGHLLVLVLAFLLWQGMQTSQQTNGDYLNEISARATRL
DGEVKAYTGKPAMAPVPALLDSARELSAWPELDPDAPPLTWRYGLYSVPPVTDSVASLYNRLLDQLLLPP
LVKRMEYVLADAIARQDSKAAYDALRIYLLLNLDKDHEDKYNAAEIQSWVINDLGNSDSVAGFGGRAAVL
THIEALFDGSRVVHSPYEKDEALIRQARAFLDGHTSTERIYARALAAMESEAPQEFTLVRAVGADAGTVF
VRSNGAPLDRGVPGIFTREGYRELFDKRLPEFVAAATANDGWVMGRESTPKKLTDSLRSQIPGQEQSVAR
EVRRLYLTEYARRWQDFLDSIHSINSAGEEGSSGLAYDLQVLRTLASPDSPLMRLGKAVVEQTTLVPPPD
PQARQKQLAQRASGNAGKVVQTAKLFQDIHPEERLEKTLVDDRFAALREVIAGRTDGGQSGGGTMQIASL
LTMLNEYYTQLTIADSALAAGTLPARITAADKLQLEAAKLPAPLKNILLDLTKQGTRKINAGTGDVLNTQ
MEAMMGDDCRDAIDGRYPFADSPQEVSAEDFNRIFASGGVLDAFWSKQLAPLADTASDPWRYKPTEGNMT
LQGPDLTPFQQAKQIRSVFFNSEGGKKFSWSMQISVVDMDPAITELVIDIDGQVLRYAHGPDRPLKVTWP
GPRNGSMAEITASPRIRQDTSTLLTGGPWALFHLLDAGMVQETAVRGRQLVEYDFDGRRVVLEITAGRDF
NPVSRELLQNFSCPARAL
 
Nucleotide Sequence: 3627 bp     [Download]
>gi|224581838|ref|NC_012125.1|:318373-321999 Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594 chromosome, complete genome
ATGCAAAAATTTCTCAGTCTGCTTTTTTCCCGGCGCGCGCTGGCGATTGTGGGCGTTCTGGTTCTGGCGC
TGCTGGTCTGGTTTGTCGGGCCGCTGGTGTCATTTGATACCCTGCGCCCACTGGCCTCCGTGGGTAGCCG
GGTAGTGACCATTGCCCTGTTGCTGATGCTGCTGGTACTGTGGCTGGTCAACTGGTCGATGAGTATCATC
GGCATCAGTGTCCTGTGCCTGGCGATTGGCTTCGTCACACCGCTGCTGGCCTTGGGCGATGTCCATCCGT
TTGCGCCGCTGTGGGTCCGCCTGACATTAATTGGTTTCATCCTGTTGGTGTATGCGCTGTACGGCCTGTA
CCGGCTGTGGCGTGCGCTGCGTATGGATGAACAACTGCTGCGTCGCTTCCTGCATCCGCGCGGGGAAGAG
GTACCGGTGGCAGGCGAGATCAAAGCCGACCTGCGCACCGTCAACCATATTGTCACGCAGGCCATCCGGC
AACTGCGGCAGTTGCGGGTGGACATGCCCGGCTGGCGTAAAATCTTCGAGGGAAAACGCTTTCTGTATGA
GCTGCCGTGGTTCATGGTGGTCGGCAGTCCCGGTGACGGAAAAACCACGGCCCTGCTGAACACCGGATTG
CAGTTCCCGCTGGCGGAGCAAATGGAGCAGACCTCGCGTATCCTGACAATGCCGGGTGGCGGCACGCTAC
ACTGCGACTGGTGGTTTACCAACGAAGCGGTGTTGATTGATACCGCCGGACGCTACGCCCGCCACGATGA
CGGTGGTGAAGCGAGCGCCGCGCAGCGTAACGCCGGAGAGTGGCAGGGCTTTCTCGGTCTGCTGCGTAAA
CATCGCCCCGGCGCGCCGCTTAACGGCGTGATCCTGACGCTAAACGTGGCGGATTTAACCGCACAGTCAC
CGGCGGAACGCCTGACGCTGCGGCTGGATCAGGGACTGGATACCCGGTTACAGGAAGAGTACGACCTTAA
AAGCCGCCAGCGGCTGTATACCTTCCCGCGTGAGTTCGCCGCCCTCGGCGAGCCGTTGCTGGAGGCTATT
GAACAGATCTTCCTCGATTCAAAATTCGATGCCACGCAACTGAATAACACGCTGCGCGGGGTGTTTTTCA
CCAGTGCCGCGCAGGCGCAGGCCGACGCCGTGGCCGACCAGTTGAGTATCTGGCAGCGCTTTGTCCGGGC
GATAAAAACCGCCCGTGGCGAATCATCCGCCTCTCTCCCACACGCTCTGCCGGACGGCAACCGCAGCTAC
TTTCTGCATGATCTGCTAACACAGTTTATTTTCCGTGAAGCGCACCTGGTGGAGCCAAACCTCCAGTGGG
CCTGGTGTTACCGCCTGCTGCGCCTCGGCGGGCACCTGCTGGTACTGGTGCTGGCATTCCTGTTGTGGCA
GGGGATGCAGACCAGCCAGCAGACCAACGGCGACTATCTGAATGAAATCAGCGCCCGCGCGACCCGGCTG
GACGGCGAGGTGAAAGCCTACACCGGTAAACCGGCGATGGCTCCCGTCCCGGCACTGCTGGACAGCGCAA
GGGAACTGTCCGCCTGGCCGGAACTGGACCCGGACGCGCCGCCGCTGACCTGGCGCTACGGCCTGTACAG
CGTACCGCCGGTAACCGACAGTGTGGCGTCGCTGTACAACCGTCTGCTGGATCAACTGCTGCTACCGCCG
CTGGTGAAACGGATGGAGTATGTGCTGGCGGATGCCATTGCCCGTCAGGACAGTAAAGCTGCCTACGATG
CCCTGCGCATCTATCTGCTGCTGAATCTGGATAAAGATCACGAAGATAAATACAACGCGGCGGAGATCCA
GTCGTGGGTGATTAACGATCTGGGGAACAGCGACAGCGTGGCCGGGTTCGGCGGGCGCGCCGCCGTGCTG
ACGCATATCGAAGCGCTGTTTGACGGCAGCCGGGTGGTGCATTCACCGTATGAGAAAGATGAGGCGCTGA
TCCGCCAGGCGCGGGCATTCCTCGACGGTCACACCAGTACCGAGCGTATCTACGCGCGGGCGCTGGCGGC
AATGGAGAGCGAAGCGCCGCAGGAGTTCACGCTGGTACGCGCCGTCGGCGCGGATGCGGGAACGGTGTTT
GTGCGTAGCAACGGCGCGCCGCTGGATCGGGGCGTGCCGGGTATTTTTACCCGTGAAGGTTACCGGGAGC
TGTTCGACAAACGATTACCGGAATTTGTGGCGGCGGCGACGGCGAACGATGGCTGGGTGATGGGCCGGGA
GAGTACGCCAAAAAAGCTGACTGACAGCCTGCGCAGCCAGATACCGGGGCAGGAGCAGTCTGTCGCCCGC
GAAGTCCGCCGTTTGTACCTGACAGAATATGCCCGCCGCTGGCAGGATTTTCTGGACAGTATCCATAGTA
TCAACAGTGCCGGGGAAGAGGGCAGTTCCGGCCTGGCCTATGATTTACAGGTGCTGCGCACCCTGGCGTC
GCCGGACTCACCGCTGATGCGGCTGGGAAAAGCGGTGGTGGAGCAGACCACGCTGGTGCCGCCGCCGGAC
CCGCAGGCCAGACAGAAACAACTGGCGCAGCGCGCATCCGGTAACGCGGGGAAAGTGGTACAGACGGCAA
AACTGTTCCAGGATATTCACCCGGAAGAACGGCTGGAAAAAACGCTGGTGGATGACCGTTTCGCCGCGCT
GCGCGAGGTCATTGCCGGGCGGACGGACGGCGGACAGAGCGGCGGTGGGACGATGCAGATCGCTTCGCTG
CTGACCATGCTCAACGAGTATTACACCCAACTGACCATTGCTGATAGCGCGCTGGCGGCGGGGACGTTGC
CAGCGCGCATTACTGCCGCAGACAAGTTGCAACTGGAGGCGGCGAAACTGCCTGCGCCGCTGAAAAACAT
CCTGCTGGATCTGACGAAGCAGGGAACGCGCAAAATCAACGCCGGGACCGGCGATGTGCTGAACACCCAG
ATGGAGGCGATGATGGGCGACGACTGCCGTGACGCCATCGACGGGCGTTATCCGTTCGCCGACAGCCCGC
AGGAGGTCAGCGCCGAGGACTTTAACCGCATCTTCGCCAGCGGCGGCGTACTGGATGCTTTCTGGAGCAA
ACAACTGGCTCCGCTGGCGGACACCGCCAGCGACCCGTGGCGCTACAAACCGACCGAAGGCAACATGACA
TTGCAGGGGCCGGATTTAACGCCGTTTCAGCAGGCGAAGCAGATCCGCAGCGTGTTTTTTAACAGCGAGG
GCGGGAAAAAATTTTCCTGGTCGATGCAGATTAGCGTGGTGGATATGGACCCGGCCATCACGGAACTGGT
GATTGATATCGACGGTCAGGTGCTGCGCTACGCCCATGGTCCGGACCGGCCCCTGAAAGTGACGTGGCCG
GGACCGCGCAACGGCTCGATGGCGGAAATCACCGCCAGCCCGCGTATTCGCCAGGACACCTCAACGCTAC
TGACCGGCGGGCCGTGGGCGCTGTTTCATCTGCTGGACGCCGGAATGGTACAGGAAACGGCGGTGCGGGG
GCGTCAACTGGTGGAATATGATTTTGACGGTCGCCGGGTGGTGCTGGAAATCACCGCCGGGCGGGATTTT
AACCCGGTCAGCCGGGAGCTGTTGCAGAACTTCAGTTGTCCGGCGAGGGCGTTGTAA
 Primer design