SecReT6
Protein ID: 225382150
SecReT6 ID793
T6SS typei1
Gene symbol-
Locus tagVEPGS_0007
StrainVibrio alginolyticus EPJS
Repliconchromosome [GenBank: FJ790776] [Browse all T6SS(s) in this replicon]
Location [Strand]8292..11681 [+]
Producttype VI secretion system IcmF
NoteTssM
UniProt IDC0LZM5, C0LZM5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 2.50E-52, Aligned region: 153..408
IcmF-related [PF06761], Evalue: 2.00E-48, Aligned region: 491..755
DUF1215 [PF06744], Evalue: 7.10E-32, Aligned region: 866..987
Protein Sequence: 1129 a.a.     [Download]
>gi|225382150|ref|ACN89291.1| type VI secretion system IcmF [Vibrio alginolyticus]
MFKQKLFRNPVVISTILMFLVVAIITTIYLLFLDEIDQLYLWLTLGAIAMVYVTFQFTLWLKKKNNAKAQ
HLETEEEALSMVIQPLLANSGKKPIYLMLGNKGSGRRQFLFNSSAIKPMDRTRTAKNDFFEWYESDSAVY
IKPDQRLVFQEVSSSDASLWNTFIEEVIHHRPRKPFSGCLFFTDFEFMIVSEPEQKEYTISSLLARLSTI
NSKTSSALPIYLIMSKLDKLDGFKEYMHFSSLKTRVEFLSIPLKEAKGVFAEYYRDSYRNLVRVLESNAL
DASANSTDIDEKQAILAFPKQFELCQSEVSYVLERLCDVNNGVYSLDIREIFFSSSLQGGRKYNLLAKSC
SNYFSLPIIASEHTQLTETPYFSRFLIDSQILPESDFAGENKTYLRLIQRQSRLAILGSIILLTGGSYFF
FTTLDSNLHVMNQLLSIDDKSQVEQDARFDELLAKATKAIEPSYGAWLKGSKALDEEILPLNISRLDQST
RIAYEALLKDVAQRLIPLIEKGCRLQLTQNQNTFTRALPLLKGYLMLNDPTKRDIRFLRHQTLQMMNDLS
NQNDVVNQAMRYLDAYFRTQFDPIDINMDLVRATRRSLLANSNVDLVYAGILNEANSIDLGTLDLQRAVG
FEFSNVFNTPIDSERLIVDKIYTSTGFSTFYRPRVDLMSQQVISDNWVLGLSQHVIPTSEEQEAFKEEVR
KKYTDDYISNWRNALSELKVQNYDNVGDLTNAIDLISGPSSPMTTVLKQVYANTQFSPVGEKNALISKLN
PKLVAAADSASDAVEEVVKPDYLLMKRVEQAFHLLNQLQVSETPNSPTPWDETVTALSRVRTYMKDIADA
PDPQMAALAAAQHRMNSSEADPLIKLKQIAQKSPEPVRSWLLDVVQQSWSVMIKESAKGIQTQWYSEIYT
KFKEIGLGRYPFDLTATEEISIEDFELLFASGGLLDTFIQKNFAPFYDTNLWTPKQVDGETMPISPALLV
QLRNYNVIRDTLINKSTNRVHIPFSARVLDLDSSAIRASLKIADTNISYYHGPSRIREMAWPPQNGDFNI
SITLQDVTDEGRQHVLNKSGQWAIYKLLGDSTLTNTHNGSFVSDIKVSGRDLSLRITPLTQKNPFTLAEL
YNFTLPESI
 
Nucleotide Sequence: 3390 bp     [Download]
>gi|225382143|gb|FJ790776|VEPGS_0007|:8292-11681
ATGTTCAAACAAAAACTGTTTAGAAATCCAGTGGTGATTTCTACTATATTGATGTTTTTAGTGGTTGCAA
TTATCACCACTATTTATCTGCTTTTTCTTGACGAAATCGATCAACTTTATCTTTGGCTGACCCTTGGTGC
TATCGCCATGGTTTACGTCACTTTTCAATTCACATTATGGTTGAAGAAAAAGAACAACGCTAAAGCTCAA
CATTTGGAAACCGAGGAAGAAGCACTTTCTATGGTTATCCAGCCTCTTCTTGCTAACTCAGGCAAGAAAC
CAATTTACCTGATGCTTGGTAATAAAGGGTCAGGGCGACGTCAATTTTTATTTAATTCTAGTGCAATTAA
ACCGATGGATCGCACTAGAACCGCTAAGAATGACTTTTTTGAATGGTACGAATCTGACAGCGCTGTGTAC
ATCAAACCAGACCAACGCTTAGTGTTCCAGGAAGTATCAAGCAGTGATGCTTCTTTATGGAATACGTTCA
TTGAAGAAGTTATTCATCATCGACCTCGAAAGCCATTTTCTGGGTGTCTATTCTTCACCGATTTCGAGTT
CATGATCGTCTCTGAGCCAGAGCAAAAAGAGTACACCATTTCGTCGTTATTGGCGCGCTTGAGTACCATC
AACTCTAAAACGTCTTCAGCATTGCCAATCTATTTGATTATGTCAAAGCTAGACAAGTTAGACGGCTTTA
AAGAATACATGCACTTTAGCTCTCTCAAGACACGTGTTGAGTTCCTCTCTATCCCACTAAAAGAAGCCAA
AGGTGTATTTGCAGAGTACTACCGCGATAGCTATCGAAATCTAGTGAGAGTGCTTGAAAGTAATGCGCTA
GATGCATCCGCTAATTCAACGGACATTGATGAGAAACAAGCAATACTCGCTTTCCCTAAGCAGTTTGAGC
TATGTCAGTCTGAAGTCAGTTATGTGCTTGAGCGTCTATGTGATGTTAACAACGGTGTCTATTCACTAGA
CATCCGTGAGATTTTCTTTAGTTCGAGTCTGCAAGGCGGTCGCAAGTACAATTTACTTGCAAAAAGTTGT
AGTAATTACTTCAGCTTACCTATTATCGCGTCAGAGCATACTCAGTTAACAGAAACGCCTTATTTCTCTC
GCTTTCTGATTGATTCACAAATATTGCCGGAAAGCGACTTTGCGGGCGAAAACAAGACGTATCTTCGTCT
AATTCAGAGACAAAGCCGTTTGGCAATACTCGGCTCTATTATCCTGCTTACTGGGGGCAGTTACTTCTTT
TTCACGACATTAGACAGTAACTTACATGTGATGAATCAACTCTTGAGTATCGATGACAAATCACAAGTGG
AGCAAGATGCAAGATTCGATGAGCTTTTAGCGAAGGCGACGAAAGCAATAGAGCCTTCTTATGGGGCGTG
GCTTAAAGGTTCTAAGGCTTTGGATGAAGAGATATTACCACTCAACATTAGCCGTTTGGATCAAAGCACT
CGCATCGCTTACGAAGCATTACTTAAGGACGTTGCTCAACGGTTGATACCTCTCATTGAGAAAGGTTGCC
GTCTACAACTGACACAAAATCAAAACACTTTTACACGCGCTTTACCTCTATTGAAGGGGTATCTAATGCT
AAACGATCCAACAAAGCGTGATATCCGTTTTTTGCGTCATCAAACTCTCCAAATGATGAACGACTTGAGC
AACCAAAATGACGTCGTCAATCAGGCGATGCGCTATTTGGACGCTTACTTTCGCACACAGTTTGATCCAA
TTGATATCAATATGGATCTTGTTCGCGCAACACGTCGCTCATTGCTAGCAAATTCGAATGTTGATCTCGT
TTATGCAGGCATTTTAAACGAAGCAAATTCGATTGATTTAGGAACCCTAGATCTGCAACGAGCTGTGGGT
TTTGAGTTTAGCAATGTGTTCAACACACCAATCGATAGCGAACGCTTGATCGTAGATAAGATCTATACCT
CCACTGGTTTTAGCACTTTTTATCGACCACGCGTGGACCTAATGTCACAACAAGTCATCAGTGACAACTG
GGTTTTAGGTCTGTCACAACACGTTATTCCTACTAGTGAAGAACAAGAAGCCTTCAAAGAGGAAGTACGT
AAAAAATATACTGACGACTACATCAGTAATTGGCGCAATGCGCTGAGTGAACTAAAAGTCCAGAACTATG
ACAATGTCGGCGATCTAACGAACGCGATAGACTTAATCTCGGGCCCTTCTTCACCAATGACAACCGTACT
GAAGCAGGTCTATGCCAACACACAATTTTCACCCGTTGGTGAAAAAAATGCTCTGATTTCAAAGCTAAAC
CCGAAACTCGTGGCAGCGGCAGACTCCGCATCAGACGCAGTAGAGGAAGTAGTTAAGCCTGATTACTTGT
TGATGAAACGTGTTGAACAAGCTTTTCACTTATTAAACCAACTTCAGGTCAGTGAAACACCAAACTCCCC
TACTCCTTGGGATGAGACCGTAACAGCGCTAAGCCGTGTTCGCACGTATATGAAAGACATTGCTGATGCA
CCTGACCCGCAAATGGCGGCGCTAGCGGCAGCTCAGCATCGAATGAACAGCAGTGAAGCTGACCCATTAA
TAAAACTTAAACAGATTGCCCAAAAATCACCGGAACCCGTTCGTAGCTGGTTGTTAGATGTGGTTCAACA
AAGCTGGTCAGTCATGATTAAAGAGTCCGCTAAAGGCATTCAAACCCAATGGTACAGCGAGATTTACACC
AAGTTTAAAGAGATAGGGCTAGGACGATACCCATTTGATCTAACAGCGACCGAGGAAATCTCAATTGAAG
ATTTTGAATTACTGTTTGCTTCAGGTGGCTTGTTAGACACATTTATTCAGAAAAATTTTGCACCGTTCTA
CGATACCAATTTGTGGACGCCAAAACAGGTGGATGGCGAGACGATGCCAATCTCTCCGGCTCTGTTAGTG
CAACTGCGTAACTATAACGTTATTCGAGACACATTAATTAATAAAAGCACTAACCGCGTTCATATTCCGT
TTAGTGCAAGAGTACTTGATCTTGATTCTAGTGCGATTAGAGCGAGCTTAAAAATTGCAGATACCAATAT
AAGTTACTACCACGGTCCAAGCCGCATTCGTGAAATGGCATGGCCACCGCAAAATGGTGACTTCAATATT
AGTATCACACTCCAGGATGTAACCGATGAAGGCAGACAGCACGTTTTAAATAAGAGTGGTCAATGGGCGA
TATACAAATTGCTAGGTGACTCGACCTTGACAAACACTCATAACGGCAGCTTTGTCAGTGACATAAAAGT
GTCAGGGAGGGACTTGAGCTTACGCATCACTCCGTTGACACAGAAAAACCCATTCACTCTTGCAGAGCTG
TATAACTTTACGCTCCCTGAGTCGATTTAA
 Primer design