SecReT6
Protein ID: 225382177
SecReT6 ID794
T6SS typei5
Gene symbol-
Locus tagVEPGS_0611
StrainVibrio alginolyticus EPJS
Repliconchromosome [GenBank: FJ790777] [Browse all T6SS(s) in this replicon]
Location [Strand]10773..14291 [+]
Producttype VI secretion system IcmF-related protein
NoteTssM
UniProt IDC0LZQ1, C0LZQ1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.00E-87, Aligned region: 79..106
ImcF-related_N [PF14331], Evalue: 1.00E-87, Aligned region: 190..452
IcmF-related [PF06761], Evalue: 7.30E-86, Aligned region: 502..805
DUF1215 [PF06744], Evalue: 5.00E-38, Aligned region: 916..1034
AAA_19 [PF13245], Evalue: 0.0059, Aligned region: 127..141
Protein Sequence: 1172 a.a.     [Download]
>gi|225382177|ref|ACN89317.1| type VI secretion system IcmF-related protein [Vibrio alginolyticus]
MRIKEIGRIFTQRWFLGLIGVAACSIFIWVVGPLITIAGYEPLKSDFQRLVTILVLVLLWAIFNVTKQHK
QKVKEDESIQTLLEVDSQSDKEAASEIDLMRERIEQAVKVVTKTHKGKRSLYDLPWYVLIGPPGTGKTTV
LKQSGLEFPLGDSLGSDSIAGVGGTRHCDWWFANKAVLIDTAGRYTTQDSQEKVDSKAWHGFLGLLKKYR
TQRPINGAIVTISLASVMSQTRTERSLHARAIKSRLQELKNQLGMQFPIYVLLTKMDLVAGFNEFFADLS
KEEREELFGFMFPREVDDERGVISLFNKEFHGMLERLDARMLRILETEDDLDKRALIFEFPKQLRVLQAN
LDEFLAEIFAQNSFEEPALIRGVFMLSSVQEGLPVDKLMNESTNGLGLNRLALAKSQTGSHSYFVKNLFD
KVIFKEQLLGTVNRHYQKQSGWMRRGVYIGCTTLLLGASALWFMSYKWNSRLIVDTNEQASHIDAMIGAQ
SLDFEADIVSAVETLDRLMTLPLGKQSNYGDADSVKRFGLYQGDKVSQAASNAYSDALTQYYAPLLLDSL
VSEMESNQQHREYLYETLKTYLMLFNPDKYQQDEVLAWFNFYFERQYPGELNVDLRRRLLQHTQYLLGND
GQGFTYNTAAVTSAREVLTQMSLPERAYQRMKIQFSKSHVPSFRLTDVLGPKGLEQFERASGKPLSQGIS
GFYTYNGFHSIFQIQINRTVKSLMEENWVYGDDLKAHEIDQDSAIQGVQSRYYQDYVNEWKTLIEDIQLK
QAPSLELATEQARVLSGVERPIESLLRAIQKEVALSKVSLSENQKAASEVVGKVAKVKFSNTADRLDMYL
PEENGFNVALPGKEVESHFSEILRLGEQDFDDIQQAMVNLRSYLSDLSSSGNNQKIAYKSILDGTVTQDV
AASFARAKELLPRPFNQWLGELSQESVKFAESGSKDHLNQLWVTQVVRPYQRTIAGRYPFEPNASREVRL
KDFKRFFGYGGTLDAFFQEYLEAFVDTSKSRWRLEKEIGVRPETLMVFQRAQRIRQSFFESDNSLRVEFG
MKPVYLDQHITRFVLELGGQDLVYKHGPARAKSLSWPAGQDQTRIVFTPPESKREIAHTYEGEWGIFKLL
DQSLKARPESRKDNIVMIDLKGNKVQLELIPSSAINPFWSNEMERFRCPRTL
 
Nucleotide Sequence: 3519 bp     [Download]
>gi|225382166|gb|FJ790777|VEPGS_0611|:10773-14291
ATGCGTATTAAAGAAATTGGCAGAATATTTACTCAAAGATGGTTTCTCGGTCTTATCGGTGTCGCTGCTT
GTTCTATTTTCATTTGGGTTGTTGGTCCACTTATTACGATAGCGGGGTATGAGCCCCTAAAGAGTGACTT
TCAACGGCTAGTCACTATTCTTGTGTTAGTGTTGCTTTGGGCGATATTTAACGTTACCAAGCAGCATAAG
CAGAAGGTGAAAGAAGACGAAAGTATTCAAACGTTGCTTGAGGTTGATAGCCAATCAGATAAAGAAGCGG
CAAGTGAAATTGACTTAATGCGCGAGCGTATTGAGCAAGCTGTCAAAGTAGTGACGAAAACACACAAAGG
CAAGAGAAGTTTGTATGACTTACCGTGGTATGTATTGATTGGCCCTCCTGGAACGGGGAAAACAACCGTA
TTAAAGCAGTCGGGGTTAGAGTTTCCATTAGGAGACAGCCTTGGCTCTGACTCTATTGCCGGTGTAGGTG
GCACTCGCCACTGTGATTGGTGGTTTGCAAATAAAGCAGTTCTTATAGATACGGCTGGCCGGTATACGAC
ACAAGACAGTCAAGAAAAGGTCGACTCTAAAGCGTGGCATGGTTTCTTAGGATTGTTGAAAAAGTATAGA
ACGCAAAGACCAATTAATGGTGCGATTGTTACGATAAGCTTAGCCAGCGTGATGTCTCAGACTCGAACCG
AGCGAAGTCTTCATGCTCGAGCAATTAAGTCGAGACTTCAAGAACTGAAAAACCAGTTAGGCATGCAGTT
TCCGATTTACGTATTGCTCACCAAAATGGATTTAGTTGCCGGTTTCAATGAGTTCTTTGCCGATTTAAGT
AAGGAAGAGCGAGAGGAATTATTTGGTTTCATGTTCCCTCGTGAAGTGGATGATGAAAGAGGCGTTATTT
CTCTATTCAACAAAGAATTTCATGGCATGTTGGAGCGCCTTGATGCCCGTATGCTTAGAATACTTGAAAC
AGAGGACGATTTAGATAAACGCGCGCTTATCTTTGAATTTCCAAAGCAATTAAGAGTGCTACAAGCTAAT
CTTGACGAGTTTTTAGCTGAAATTTTTGCACAAAACAGTTTTGAAGAGCCTGCCTTGATTCGTGGTGTGT
TTATGTTGAGTTCGGTTCAAGAAGGCTTACCAGTCGATAAGCTGATGAATGAATCAACCAATGGACTTGG
GTTAAATCGTTTAGCTCTAGCAAAGAGTCAGACTGGTTCTCATAGTTATTTCGTAAAGAATCTTTTTGAC
AAGGTTATTTTCAAAGAGCAACTGTTAGGAACAGTTAATCGTCACTATCAAAAGCAGTCAGGTTGGATGC
GTCGAGGTGTTTATATTGGATGTACAACGCTACTGCTAGGAGCTTCTGCGCTTTGGTTTATGAGTTATAA
GTGGAACTCACGGTTAATTGTCGACACCAATGAACAAGCTAGCCATATTGATGCAATGATTGGCGCTCAA
AGTTTAGATTTTGAAGCGGATATTGTTTCAGCTGTAGAAACATTAGATAGGTTGATGACGCTTCCTCTCG
GAAAGCAAAGCAACTACGGTGATGCCGACTCTGTAAAGAGGTTTGGTCTCTATCAAGGAGACAAAGTATC
TCAGGCGGCAAGCAATGCATATTCTGATGCTTTGACCCAATATTACGCCCCTTTGCTTCTTGATAGCCTG
GTGTCAGAAATGGAGAGCAATCAACAGCATCGTGAGTATTTGTACGAAACGTTAAAAACGTATTTGATGT
TATTCAATCCAGACAAATATCAACAAGATGAAGTGTTGGCTTGGTTTAACTTTTATTTCGAACGTCAATA
TCCGGGTGAGCTAAACGTAGACTTAAGAAGACGCTTGCTACAGCACACTCAATATTTATTAGGCAACGAT
GGACAAGGCTTTACTTACAACACTGCTGCTGTGACGAGTGCTCGAGAAGTGTTGACTCAAATGTCTCTAC
CTGAACGTGCTTATCAGCGAATGAAAATACAATTTTCTAAGAGTCATGTACCTTCATTTCGCTTGACTGA
TGTATTGGGACCTAAAGGGCTTGAGCAGTTCGAGCGAGCGAGTGGAAAACCGCTATCACAAGGCATTTCG
GGCTTCTACACGTACAATGGTTTTCATAGCATTTTTCAGATTCAGATCAACCGTACAGTAAAAAGCCTAA
TGGAAGAGAACTGGGTTTATGGTGACGATCTTAAGGCCCATGAAATTGATCAAGATAGTGCCATCCAAGG
CGTTCAGTCTCGATACTATCAAGATTATGTTAATGAATGGAAAACGTTGATCGAAGATATTCAATTGAAG
CAGGCTCCGAGCCTAGAACTTGCGACAGAGCAAGCGAGGGTTTTATCTGGAGTCGAAAGACCAATCGAAT
CTTTGTTGAGAGCAATCCAAAAAGAGGTTGCTCTATCAAAAGTATCATTGTCAGAAAATCAAAAAGCCGC
TTCTGAAGTTGTTGGTAAAGTTGCCAAAGTTAAGTTTTCAAATACGGCAGATAGACTAGACATGTATTTA
CCTGAAGAAAACGGTTTCAATGTTGCTCTGCCAGGTAAAGAAGTCGAATCGCATTTTTCAGAGATCTTAC
GCCTTGGTGAGCAAGACTTTGATGATATTCAACAAGCAATGGTTAACTTGCGTTCGTATTTAAGTGACTT
ATCAAGCTCTGGTAACAATCAGAAAATTGCCTACAAAAGTATTTTAGATGGAACCGTTACACAAGATGTC
GCAGCTTCCTTTGCTCGTGCTAAAGAACTTTTGCCGAGACCATTTAATCAATGGCTAGGTGAGCTTTCTC
AAGAGTCGGTTAAGTTTGCGGAGAGCGGTTCGAAGGATCATCTAAATCAACTTTGGGTAACACAGGTGGT
CCGCCCTTATCAGCGGACTATTGCTGGCAGATATCCATTCGAGCCCAACGCGAGCAGAGAAGTTAGATTG
AAAGACTTTAAGCGATTCTTTGGTTATGGAGGTACGCTTGACGCATTCTTCCAAGAATACCTCGAAGCGT
TTGTGGATACTTCGAAAAGTCGTTGGCGATTAGAAAAAGAAATTGGAGTTCGTCCAGAAACACTAATGGT
CTTTCAAAGAGCGCAACGTATCAGGCAGTCTTTCTTTGAATCCGATAATTCCTTACGCGTAGAGTTTGGG
ATGAAGCCTGTTTATCTAGACCAGCACATTACTCGATTTGTCTTAGAGTTGGGTGGACAAGATTTGGTTT
ATAAGCATGGACCAGCAAGAGCTAAATCGTTGAGTTGGCCTGCCGGTCAAGATCAGACTCGAATTGTGTT
CACACCACCTGAATCTAAACGCGAAATTGCGCATACCTATGAAGGTGAGTGGGGCATATTCAAGCTTTTG
GATCAATCACTTAAAGCAAGGCCAGAATCGCGTAAAGACAATATAGTTATGATTGATTTAAAGGGAAATA
AGGTGCAACTAGAGCTTATTCCTTCTAGTGCCATTAATCCGTTTTGGTCAAATGAAATGGAGAGGTTCAG
ATGTCCACGAACCTTATAA
 Primer design