SecReT6
Protein ID: 226229271
SecReT6 ID332
T6SS typei4b
Gene symbol-
Locus tagGAU_3865
StrainGemmatimonas aurantiaca T-27
Repliconchromosome [GenBank: NC_012489] [Browse all T6SS(s) in this replicon]
Location [Strand]4553482..4557009 [-]
Producthypothetical membrane protein
NoteTssM
UniProt IDC1AEI0
KEGG IDgau:GAU_3865
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 2.40E-39, Aligned region: 208..239
IcmF-related [PF06761], Evalue: 2.40E-39, Aligned region: 495..794
ImcF-related_N [PF14331], Evalue: 3.50E-35, Aligned region: 190..444
DUF1215 [PF06744], Evalue: 4.80E-18, Aligned region: 716..755
DUF1215 [PF06744], Evalue: 4.80E-18, Aligned region: 888..914
DUF1215 [PF06744], Evalue: 4.80E-18, Aligned region: 960..1035
Protein Sequence: 1175 a.a.     [Download]
>gi|226229271|ref|YP_002763377.1| hypothetical membrane protein [Gemmatimonas aurantiaca T-27]
MASRKPIIRWIIAAAVLLLFLVILLVLERTMALDPVALWVLRVGLVLLGLIAAGAILWFLRPQDQEPVLD
QGDDVLLAIGAARARLPRGSFASRALVLLLGPEGSAKTTLVARSGGDPQLLAGDAPAGANDVPPSTKTAN
VWAMQNAVVAELASGLLSDAPRFAKVVRALRAPRVAAAVGQGDAAPRAAVVCVPADLFYAGGNGEQLQQL
AQSMRQRLAEAARELGLALPVYVMFTKMDRVPHFEPWVSVFTKDELRAPLGATLPFDATSNTGNYAERLA
PRLDVAFSEIAQSVGSRRVDLLGRETQIDRRYASYELPRELQKLQTAATQFLVELCRPTQLGTSPQLRGF
YFTGARPVVVTDVGVAAAAAAPQAAAGATGVFRRPEMPTAAAAAAPVSRRVPEWVFLDRFLRDVVLTDTG
AASVARGGVSVQRTRRVLLGTAIAATVLLLLGVTASWLGNRSLQGRVSSAASAVAALPVVQAAPGTIAFP
SAEALTRLDALRAQLDTLQAYEQDGPPLRMRFGLWRGTALLDAARPVWFDGFRKQLFADAWGALNDSLKA
LPDIPTAANDYGVSYGWLKGYLITTTTPDSSTSEFLTPVLLTSWQRGMATDADITALARRQFEYYAGVLP
KTNPYPRAADAAVVSHARDFLSRFTGAEQIYLNMIGAANKQAPPVAIPQAPGLLTATAEVQGAFSTKGAS
FMSDAFRNADRYFQGETWVVGDATASQSVNRDSVVTALRGRYADDYVRTWRQVVQSATVVRPATVKDAAD
KLDKLAGVQSPLLQVLRTVAVNTAIDSAMRQAFQPVHAVTPPEITDKFVSEKNQPYMDGLLGLQGALLQV
SNMPPAVDTPSTQALVMAAQMAAGDVTKARVSAKRVSQGFDVSNVGGALASPVEQLLLAPITGAEAVLKT
AASQRPPARRIAAAPAAPAAPAGGGGGAPNNAPEIAALNERGRAICTRIDQLTSRFPFNPDATADASVAD
VKAILAPGTGELWVFQQERLAPYLEKSGNTWALKPGGKIELSKSFVDFFNRAAEVSGALFAEDPTTPMVR
WLASGVITPNTPLLTLKNNGKEARFDQRSFKNEVVWPATNGREAELLAQFKKNKPVTVRKANGDWAIFRL
VSAADAFEGQSVTWNATGKDAEPVMVKFEALRREASSVLTRGWLGRMSCVSQVTK
 
Nucleotide Sequence: 3528 bp     [Download]
>ref|NC_012489.1|:c4557009-4553482 hypothetical membrane protein [Gemmatimonas aurantiaca T-27]
ATGGCGTCTCGCAAGCCTATCATCCGGTGGATCATCGCCGCCGCGGTATTGTTGTTGTTCCTCGTCATCC
TCCTCGTGCTCGAGCGCACGATGGCCCTGGATCCCGTGGCGCTGTGGGTGCTGCGGGTGGGGCTGGTGCT
GCTCGGCCTGATTGCGGCTGGCGCCATTCTCTGGTTCCTGCGGCCGCAGGATCAGGAACCCGTGCTCGAT
CAGGGCGACGATGTGCTGCTGGCGATCGGTGCCGCCCGCGCCCGTCTGCCCCGTGGCAGCTTTGCTTCGC
GTGCGTTGGTGCTGCTCCTGGGGCCCGAGGGCAGCGCGAAGACCACGTTGGTGGCGCGGTCGGGCGGCGA
TCCGCAGTTGCTGGCGGGTGATGCACCGGCTGGCGCGAACGATGTGCCGCCGTCGACCAAGACCGCCAAT
GTGTGGGCGATGCAGAACGCGGTGGTGGCCGAACTGGCGAGTGGGCTGCTCTCCGACGCCCCGCGCTTTG
CCAAAGTGGTGCGTGCCCTGCGCGCGCCGCGTGTGGCCGCGGCCGTGGGGCAGGGTGACGCGGCGCCGCG
TGCCGCTGTGGTGTGTGTCCCGGCCGATCTGTTTTATGCTGGCGGCAACGGCGAGCAGTTGCAGCAGCTC
GCGCAGTCCATGCGTCAGCGTTTGGCCGAAGCGGCGCGCGAACTGGGACTCGCCCTGCCGGTGTACGTGA
TGTTCACGAAGATGGATCGTGTGCCGCACTTCGAGCCGTGGGTGAGTGTGTTCACGAAGGACGAGTTGCG
CGCGCCGCTGGGCGCGACGCTGCCCTTCGATGCCACGTCGAACACCGGCAACTATGCCGAACGCCTCGCT
CCGCGACTGGACGTGGCGTTTTCGGAGATTGCGCAGTCGGTGGGATCACGTCGCGTGGACCTGCTGGGAC
GCGAGACGCAGATCGATCGACGTTATGCGTCCTATGAATTGCCGCGCGAACTGCAGAAGCTGCAAACGGC
CGCAACGCAGTTCCTGGTGGAGTTGTGCCGGCCGACGCAGTTGGGCACGAGCCCGCAGTTGCGCGGCTTC
TACTTCACGGGCGCGCGTCCGGTGGTGGTGACGGATGTCGGGGTGGCTGCGGCTGCCGCAGCACCGCAGG
CCGCCGCCGGTGCAACGGGTGTTTTCCGTCGCCCCGAAATGCCGACGGCGGCCGCCGCGGCGGCGCCGGT
TTCGCGACGGGTGCCGGAGTGGGTGTTCCTCGATCGTTTCCTGCGTGACGTGGTGCTCACCGATACCGGT
GCGGCATCGGTGGCGCGTGGTGGCGTGAGTGTGCAGCGCACGCGACGTGTGTTGCTGGGCACGGCGATTG
CCGCGACGGTGTTGTTGCTGCTGGGCGTGACGGCGTCATGGTTGGGCAACCGTTCGCTGCAGGGTCGGGT
ATCCAGCGCAGCCAGTGCCGTGGCGGCCTTGCCGGTGGTGCAGGCGGCGCCGGGCACGATCGCGTTTCCG
AGCGCCGAAGCGCTCACCCGTCTCGATGCACTGCGCGCGCAGCTCGACACCCTGCAGGCGTACGAACAGG
ATGGTCCGCCGCTGCGCATGCGGTTTGGCCTGTGGCGTGGTACGGCGCTGCTGGATGCGGCGCGGCCCGT
GTGGTTCGACGGCTTCCGCAAGCAGCTCTTCGCCGATGCCTGGGGCGCACTCAATGATTCGCTCAAGGCC
CTGCCGGACATTCCCACGGCGGCGAACGACTACGGCGTGTCGTACGGTTGGCTCAAGGGTTACCTGATCA
CGACCACCACGCCGGACAGCAGCACGTCGGAGTTCCTCACGCCGGTGCTGCTCACGAGCTGGCAGCGGGG
CATGGCCACTGACGCCGACATCACGGCGCTCGCCCGTCGGCAGTTCGAGTACTACGCCGGTGTGCTGCCG
AAGACCAATCCGTATCCACGCGCCGCCGACGCGGCTGTGGTGAGTCATGCGCGGGATTTCCTGTCGCGCT
TCACTGGTGCGGAGCAGATCTATCTGAACATGATCGGCGCCGCCAACAAGCAGGCGCCACCAGTGGCCAT
TCCCCAGGCGCCGGGTTTGCTGACGGCGACGGCGGAAGTGCAGGGTGCTTTCAGCACGAAGGGGGCGTCG
TTCATGAGCGATGCCTTCCGCAATGCCGATCGCTACTTCCAGGGTGAGACCTGGGTGGTGGGTGATGCCA
CCGCGTCGCAGTCGGTGAACCGCGATTCGGTGGTGACGGCACTGCGCGGCCGGTATGCCGACGACTACGT
GCGCACCTGGCGTCAGGTGGTGCAGAGCGCCACGGTGGTGCGTCCGGCCACGGTGAAGGACGCCGCCGAC
AAACTCGACAAGCTGGCCGGTGTGCAGTCGCCCTTGTTGCAGGTGTTGCGCACGGTGGCGGTGAACACGG
CGATCGATTCAGCGATGCGGCAGGCGTTCCAGCCCGTGCACGCGGTCACGCCGCCGGAGATCACCGACAA
GTTCGTCTCCGAAAAGAATCAGCCCTACATGGACGGCTTGCTCGGCTTGCAGGGGGCGCTGTTGCAGGTG
TCGAACATGCCGCCGGCCGTGGACACGCCCAGCACGCAGGCACTGGTGATGGCGGCGCAGATGGCCGCTG
GTGATGTCACGAAGGCGCGTGTGTCCGCCAAGCGGGTGTCGCAGGGCTTCGATGTGAGCAATGTGGGTGG
CGCGCTCGCGTCGCCGGTGGAGCAGCTCTTGCTGGCACCGATCACGGGCGCGGAAGCGGTGCTCAAGACC
GCCGCCTCACAGCGGCCGCCGGCACGTCGCATCGCAGCGGCGCCTGCGGCACCCGCCGCTCCGGCTGGCG
GCGGTGGTGGTGCTCCCAACAACGCTCCAGAAATCGCGGCGCTCAATGAACGTGGACGCGCGATTTGTAC
ACGTATCGATCAGCTCACGTCGCGCTTCCCGTTCAACCCGGATGCGACGGCTGATGCAAGCGTGGCGGAC
GTGAAGGCGATTCTGGCGCCCGGCACTGGTGAGTTGTGGGTGTTCCAGCAGGAGCGTCTCGCGCCGTATC
TCGAGAAGTCCGGCAACACGTGGGCGCTGAAGCCGGGTGGCAAGATCGAATTGTCGAAGAGCTTCGTCGA
CTTCTTCAATCGCGCCGCCGAAGTGTCGGGCGCCTTGTTTGCCGAAGATCCCACCACGCCCATGGTGCGC
TGGCTGGCGAGTGGTGTGATCACACCCAACACGCCGCTGCTCACGCTCAAGAACAACGGCAAGGAAGCGC
GCTTCGATCAGCGCTCGTTCAAGAACGAAGTGGTGTGGCCGGCCACCAACGGCCGTGAAGCCGAACTGCT
CGCACAGTTCAAGAAGAACAAGCCGGTCACGGTGCGAAAGGCGAACGGTGACTGGGCCATCTTCCGTCTG
GTGTCGGCTGCCGATGCCTTTGAAGGTCAGAGCGTGACGTGGAACGCCACGGGCAAGGACGCGGAACCGG
TGATGGTGAAGTTCGAAGCGCTGCGCCGTGAAGCGTCGTCGGTGCTGACGCGCGGCTGGCTGGGTCGTAT
GAGCTGCGTTTCGCAGGTCACGAAGTAA
 Primer design