SecReT6
Protein ID: 226947065
SecReT6 ID334
T6SS typei4a
Gene symbol-
Locus tagAvin_50760
StrainAzotobacter vinelandii DJ
Repliconchromosome [GenBank: NC_012560] [Browse all T6SS(s) in this replicon]
Location [Strand]5142608..5146426 [-]
Producthypothetical protein
NoteTssM
UniProt IDC1DM86
KEGG IDavn:Avin_50760
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 3.10E-31, Aligned region: 116..355
Protein Sequence: 1272 a.a.     [Download]
>gi|226947065|ref|YP_002802138.1| unnamed protein product [Azotobacter vinelandii DJ]
MSLPEIDVAVIVALLLLLAAALLLAWLRSQAGSAVRGFYAAVRQMEHDRAVNDRYQTPWLLMIGDEERCA
QLCLDWQLKAAGKPAWFGCWWSDPDGALLVVPDALCMPEEGRPGRSAAWWRVLGLLLRLRSSRPLDALVW
VVPVAVLLDGEQAVARGIAARRAFIELLQRLGLSLPVYVLVTGMEEVPGFQELIAALPEEARETPLGWSS
PFAPEAAWQSHWSDLALDRLGRALSEAIVELGALSGRLGEALYCLPQRFEDMRGGLHALLDPVFQGNALG
EAPRLRGLYFVAGRAAAGGEPGQDLSGLDVPPLRGLFSRQLWQRRILAEQGLARAVPRILRLRQRWQQVA
GAAALVFGLFWSGAMLWVWYESSREAEDLARLLQETRNRYVALDDDARHRELSRQNAQAFWTLLERAPRW
RFASPAFPTSWLSPLDRRLEASLAGAARERLFQPLRDQLAADLDALGAMHGAGRHSSPEGDSPEQWQNYV
LAKGLVERVTRLEQQNRWLAQALGRPLAPLETLAAMGRDALGLQPGAGPLRHEAFYNRLLRTAPAPAMQA
LDLHANRKIAERFQNLMRQWLTQYFLAEHFVRPAGYLKIHLQKLQAGYGNSLRELEEVGGLIDNLRDLVA
LINAAWARGNGRDRVPGYEAMLDGARQTTLLGPAVVQAVEQEASRLQKSFRDQWIAQAGSRDNLLVLLGG
GSLELQEQVAGLDKSIESLLRHDFAAIALRREGEGEGEDESRAQPLAIDARALDTALGYYAGYKGYADQE
LAQIPPPYRAALLGAAARAASLAMWSSLESKGGVPRLGSERSFDVPADKALQLQEAFAELNSGDLAQALL
ENLNRRALGDVQEALAEVEALPMFHQGYDFALWDGGKGPGLQMFRAQDLQDLKQGLAQQFAVMLEATQAS
ARALEWLRMQRSHLSLADYDKVLRLTALGEEMLKHKAQNPASAPALFQQLVARDFVEMDGGTCPGILQAA
YLAQGQDDLSRRGQFLWEEARQRCDLLQQQRAATAWSRLADYFNQYLAERFPFSHDIRAVDVDPERVRHL
LRLIDEHLPQAEAGLQLARRSDRQAAQDFLLRLKQASGWLGALLLRDKNGLQGLDAEVRWRTDRADERGA
DQVIAWLLQAGRQEIAYPGDDPQRLRWTQGEPVRLVLRWAKNGSQRPVNDPLQPSLAVADREAGWEYTGP
WALLRLMRTHIAVQRQSYVDYTDFPLTFQLPVYGAYSSDSRAILFMRVSLMTQGGKAPLSIQPLPVRAPR
SPFAAPSVPQRW
 
Nucleotide Sequence: 3819 bp     [Download]
>gi|226942170|ref|NC_012560.1|:c5146426-5142608 Azotobacter vinelandii DJ chromosome, complete genome
ATGAGCCTGCCGGAAATCGACGTGGCCGTGATTGTCGCGCTCCTGCTGTTGCTGGCGGCCGCGCTGTTGC
TCGCCTGGCTGCGCAGCCAGGCGGGCTCGGCGGTGCGCGGCTTCTATGCCGCGGTTCGCCAGATGGAGCA
CGACCGGGCGGTGAACGATCGCTACCAGACGCCCTGGCTGCTGATGATCGGCGACGAGGAACGCTGCGCG
CAGCTATGCCTGGACTGGCAGTTGAAGGCGGCCGGCAAGCCCGCCTGGTTCGGTTGCTGGTGGAGCGACC
CGGATGGCGCGCTGTTGGTCGTGCCGGATGCCCTGTGCATGCCGGAGGAAGGCCGGCCGGGCCGCTCCGC
CGCCTGGTGGCGGGTGCTCGGCCTGCTGCTGCGCCTGCGCTCCAGCCGCCCCCTGGATGCGCTGGTCTGG
GTCGTGCCGGTCGCCGTCCTGCTGGATGGCGAGCAGGCCGTGGCCCGCGGAATCGCCGCGCGCCGTGCTT
TCATCGAGCTGCTGCAGCGCCTGGGACTCAGCCTGCCGGTCTATGTGCTGGTGACCGGCATGGAGGAAGT
GCCCGGCTTCCAGGAACTGATCGCGGCGCTGCCCGAGGAGGCGCGCGAGACACCGCTCGGCTGGTCCTCG
CCTTTCGCGCCGGAGGCCGCCTGGCAGTCGCACTGGAGCGATCTGGCTCTCGATCGGCTGGGGCGCGCGC
TGTCCGAGGCGATCGTCGAGCTCGGCGCGCTGTCGGGACGGCTCGGCGAGGCCCTGTATTGCCTGCCGCA
GCGCTTCGAGGACATGCGCGGCGGCCTGCACGCGCTGCTCGACCCGGTGTTCCAGGGCAACGCCCTGGGC
GAGGCGCCGCGCTTGCGCGGCCTGTACTTCGTCGCCGGCCGGGCGGCAGCGGGCGGCGAACCGGGCCAGG
ACCTGTCGGGCCTCGACGTGCCGCCGCTGCGTGGCCTGTTCTCCCGTCAGCTCTGGCAGCGCCGCATCCT
CGCCGAGCAGGGGCTGGCCCGGGCGGTGCCGCGCATCCTCCGCCTGCGCCAGCGCTGGCAGCAGGTCGCC
GGTGCCGCCGCCCTGGTGTTCGGCCTGTTCTGGAGCGGAGCGATGCTGTGGGTCTGGTACGAGTCAAGCC
GCGAGGCCGAGGATCTGGCCAGGCTGCTGCAGGAAACCCGCAACCGCTACGTGGCGCTCGACGACGACGC
CCGCCACCGGGAGCTGAGCCGGCAGAACGCCCAGGCCTTCTGGACCCTGCTGGAACGCGCGCCGCGCTGG
CGTTTCGCGTCTCCGGCCTTTCCGACCTCCTGGCTCTCGCCGCTGGACCGTCGGCTGGAGGCAAGCCTGG
CGGGCGCTGCGCGGGAGCGGCTGTTCCAGCCGCTGCGCGACCAGTTGGCGGCCGATCTGGATGCACTGGG
TGCGATGCACGGTGCCGGGCGGCATTCCAGCCCCGAGGGCGACAGCCCCGAGCAGTGGCAGAACTATGTC
CTGGCCAAGGGCCTGGTCGAGCGGGTCACGCGCCTCGAACAGCAGAACCGCTGGCTCGCCCAGGCCCTGG
GCAGGCCCCTGGCGCCCCTGGAAACCCTCGCCGCCATGGGCCGCGATGCGCTTGGCCTGCAGCCGGGCGC
CGGGCCGCTGCGCCACGAGGCCTTCTACAACAGGCTCCTGCGCACGGCGCCCGCGCCGGCGATGCAGGCG
CTGGACCTGCACGCGAACCGGAAGATCGCCGAACGTTTCCAGAACCTGATGCGGCAGTGGCTGACCCAGT
ATTTCCTGGCCGAACACTTCGTCCGGCCGGCCGGCTACCTGAAGATTCACCTCCAGAAGCTGCAGGCCGG
CTACGGCAACTCCCTGCGCGAACTCGAGGAGGTCGGCGGGCTGATCGACAACCTGCGGGATCTCGTCGCC
CTGATCAACGCGGCCTGGGCGCGCGGCAACGGGCGGGACCGGGTGCCGGGCTACGAGGCGATGCTCGATG
GCGCGCGCCAGACCACCCTGCTCGGGCCGGCGGTGGTACAGGCCGTCGAGCAGGAGGCCTCGCGCCTGCA
GAAGAGCTTCCGCGACCAGTGGATCGCCCAGGCGGGCTCGCGCGACAACCTGCTGGTGCTGCTGGGCGGC
GGCAGTCTGGAACTGCAGGAGCAGGTCGCCGGGCTGGATAAGTCCATCGAAAGCCTGCTACGGCACGATT
TCGCCGCCATCGCCTTGCGCCGCGAGGGCGAGGGCGAGGGCGAGGATGAGTCCCGCGCCCAGCCCCTGGC
CATCGATGCCCGCGCGCTCGACACCGCGCTGGGCTACTACGCCGGCTACAAGGGTTATGCCGACCAGGAG
CTGGCGCAGATACCGCCGCCGTACCGTGCGGCCCTGCTCGGAGCGGCCGCACGCGCGGCTTCGCTGGCCA
TGTGGAGCAGCCTGGAGTCGAAGGGGGGCGTGCCGCGCCTGGGCAGCGAGCGTTCCTTCGACGTGCCGGC
GGACAAGGCCCTGCAACTGCAGGAGGCTTTCGCCGAGCTGAACAGTGGCGATCTGGCCCAGGCTTTGCTG
GAAAACCTCAACCGCCGGGCCCTGGGCGACGTGCAAGAAGCGCTGGCGGAGGTCGAGGCGCTGCCCATGT
TCCACCAGGGCTACGACTTCGCTCTGTGGGATGGCGGCAAGGGACCGGGCCTGCAGATGTTCCGCGCCCA
GGATCTGCAGGACCTCAAGCAGGGGCTGGCCCAGCAGTTCGCGGTCATGCTGGAAGCCACCCAGGCCAGC
GCCCGGGCGCTGGAATGGCTGCGGATGCAGCGCTCGCACCTGTCGCTGGCCGACTACGACAAGGTCCTGC
GGCTGACCGCGCTGGGCGAGGAGATGCTCAAGCACAAGGCGCAGAACCCGGCCAGCGCGCCGGCGCTGTT
CCAGCAACTGGTCGCCCGCGACTTCGTCGAGATGGACGGCGGAACCTGCCCGGGCATCCTCCAGGCCGCC
TATCTGGCGCAGGGACAGGATGACCTGTCGCGGCGCGGGCAGTTCCTCTGGGAGGAGGCGCGGCAGCGCT
GCGACCTCCTCCAGCAACAGCGCGCGGCCACCGCCTGGAGCCGCCTGGCCGACTATTTCAACCAGTATCT
GGCCGAGCGCTTCCCGTTCTCCCACGATATCCGTGCCGTCGATGTCGATCCCGAACGGGTTCGCCACCTG
CTGCGGCTGATCGACGAGCACCTGCCCCAGGCCGAGGCGGGCCTGCAACTCGCCCGCCGGTCCGACCGGC
AGGCCGCGCAGGACTTTCTGCTGCGTCTGAAGCAGGCCTCCGGTTGGCTGGGAGCGTTGCTGCTGCGCGA
CAAGAACGGTCTGCAGGGGCTCGACGCGGAGGTGCGCTGGCGCACCGACCGCGCGGACGAGCGCGGCGCC
GACCAGGTGATCGCCTGGCTGCTGCAGGCGGGCCGCCAGGAGATCGCCTATCCGGGCGACGATCCGCAGC
GCCTGCGCTGGACCCAGGGCGAACCGGTCCGCCTGGTGCTGCGCTGGGCGAAGAACGGCTCGCAGCGGCC
GGTGAACGATCCGCTGCAGCCGAGCCTGGCGGTCGCCGACCGCGAGGCCGGCTGGGAATACACCGGTCCC
TGGGCGCTGCTGCGCCTGATGCGTACCCACATCGCCGTGCAGCGGCAGTCGTACGTCGACTACACCGACT
TCCCGCTGACCTTCCAGTTGCCGGTCTACGGGGCTTACAGCAGCGACAGCCGGGCGATCCTGTTCATGCG
CGTGTCGCTGATGACCCAGGGCGGCAAGGCGCCGCTCTCCATCCAGCCGCTGCCGGTACGTGCCCCCCGT
TCCCCTTTCGCCGCGCCGTCCGTGCCGCAGCGCTGGTGA
 Primer design