SecReT6
Protein ID: 227811746
SecReT6 ID335
T6SS typei1
Gene symbol-
Locus tagVCM66_A0118
StrainVibrio cholerae M66-2
Repliconchromosome II [GenBank: NC_012580] [Browse all T6SS(s) in this replicon]
Location [Strand]132461..136006 [+]
ProductIcmF-related protein
NoteTssM
UniProt IDC3LUE4
KEGG IDvcm:VCM66_A0118
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 4.90E-93, Aligned region: 509..825
ImcF-related_N [PF14331], Evalue: 4.90E-81, Aligned region: 201..458
DUF1215 [PF06744], Evalue: 2.80E-38, Aligned region: 919..1039
Protein Sequence: 1181 a.a.     [Download]
>gi|227811746|ref|YP_002811756.1| IcmF-related protein [Vibrio cholerae M66-2]
MWKFIVGIVRRLKPTVVAALPILLFTTFILLNVAIWWAGPWLEVAGYKPLESIMARVVASSLFTLGCLAV
WGIWQWRKLQAFKSEQKREEQLRQDPIKVYEQRQEVELNQVMLNMKQSLNKHNYLYALPWYLVLGLENAG
KTSLINRSGQNFVFSSVMRASGQKSENPYSFDWWIGDESVLIDPDGELLTQGNRSEENDGALERRLWLHF
VDWLDRTRSRRPLNGIVLALDVAHLATATASERKAYANLLRARLRELMETLSTRLPVYIALTKLDLLHGF
EPFFKHYTKSQREEVLGFTFSMDSVDNLDSWLEEFASEYTQFVSRVNGMLPHAVAAPMTLEERNAIYSFT
RQISGLKEILQQFFQEALASDQFSTSALVRGAYFTSVYQQGVPTNAFDDAASRRYGLSHAINTAQRAKNS
TVYFTQKLFTHIIYPEAGLASDNFRVAKNKRRLMGLSFVACSVATLLLAGTWHRNYLNNVQHADTVLTKV
NQYKEQFPTSRSLASQREVLDPLNKIREATLEFGFFRDKPQYISDFGLYQGHTIGPKVEETYLNLLETRF
LPLLMADTIVALNQAETDEEKLAVLRVYRMLVDKSGRYQDYVMDYFAKYWQKSFSGQRQIQEELLGHLDY
AMRHTDLTAERLNGDKGAEQVMRPYDKVIARAQVELGSMPNDQRVYRNLKLSAQTVLGPSVNLRSLIGPV
FDVVFEERVLNSSSLFIPQMLTKRGFDDYFMPQSESVSELALIDSWVLGQSKTAQFSEADKQALREKIRD
LYVADYTNTWRAALNEIDVKYFNDINDAVMVLENITSNLEPMQRLLRTLDDNTQLYSALPKDESALKELL
KSPKYKVASMIETPFADLNGMLKPVGSKPAYMTEVLASVDELKSYLKSIQDAPDVGMAALDATKARVKLV
NADPIYTLKRISSGLPKPLDSMMAKLADESWYVVKQEAIKHLEVRWTEDVYKTFQSKLAGRYPFNPASNK
DVALADFEAFFAPNGTLDNFYNQQLKMFIDENISVASDDSAQSIIRKEVLDQIKQAQKIREAFFNRKGIL
DVSFSVEPLSLSNNKRRSVLNVDGQFLAYSHGPRENVELIWPNTLRDSAVSKVTLIPTQTNMSPRSLQIQ
GPWAFFRLLDQGDVVSASQTSVDFKFIVDGGEMIYRINAEADANPFTERLFKSFKLSKTLY
 
Nucleotide Sequence: 3546 bp     [Download]
>gi|227811634|ref|NC_012580.1|:132461-136006 Vibrio cholerae M66-2 chromosome II, complete genome
ATGTGGAAATTCATTGTTGGAATAGTAAGGCGGCTTAAACCCACGGTGGTGGCAGCACTTCCCATTTTGC
TATTCACTACGTTCATTTTGCTGAACGTTGCCATTTGGTGGGCAGGCCCTTGGTTAGAAGTGGCTGGCTA
TAAACCGCTGGAGTCGATCATGGCTCGAGTTGTGGCAAGCAGTCTGTTTACTCTCGGCTGTTTAGCCGTG
TGGGGCATTTGGCAGTGGCGTAAGTTGCAAGCCTTCAAATCGGAGCAAAAGCGCGAAGAGCAACTGCGCC
AAGATCCGATCAAGGTGTATGAGCAGCGCCAAGAGGTTGAACTGAATCAGGTGATGCTCAATATGAAGCA
GAGCCTAAATAAACACAACTACTTGTATGCACTACCTTGGTATTTGGTTCTAGGTTTAGAAAATGCGGGT
AAAACCAGCCTGATCAACCGTTCTGGTCAGAACTTTGTCTTCTCTTCGGTCATGCGAGCTTCGGGACAAA
AAAGCGAAAACCCATACTCGTTTGATTGGTGGATTGGTGATGAATCTGTCCTGATTGATCCTGATGGTGA
GCTGTTAACGCAAGGCAATCGTAGTGAAGAAAATGATGGTGCGTTAGAGCGCCGCTTATGGTTGCATTTT
GTCGATTGGCTAGACCGCACTCGTAGCCGCCGCCCGTTAAACGGCATCGTGTTGGCGTTGGATGTGGCGC
ATCTTGCTACCGCCACCGCCTCAGAGCGTAAAGCTTATGCCAATTTGCTGCGTGCTCGTCTGCGTGAGTT
GATGGAAACCTTATCGACTCGTCTGCCGGTGTACATTGCACTGACTAAGCTCGACTTACTGCACGGTTTT
GAGCCTTTCTTTAAGCACTACACCAAAAGTCAGCGCGAAGAGGTGTTGGGTTTTACCTTCTCAATGGATT
CGGTAGATAACCTAGATTCATGGTTGGAAGAGTTTGCCAGTGAGTACACTCAATTTGTGTCACGAGTTAA
TGGCATGCTGCCGCATGCGGTCGCAGCGCCAATGACGCTTGAAGAACGTAACGCGATTTACAGCTTCACG
CGTCAAATCTCAGGTTTGAAAGAGATTTTGCAACAGTTTTTCCAAGAGGCTTTGGCGAGCGATCAATTCT
CAACGTCAGCGCTGGTGCGTGGTGCCTATTTCACGTCGGTTTACCAACAAGGTGTACCTACCAACGCTTT
TGATGATGCGGCTTCCCGTCGTTATGGTCTGTCTCATGCGATTAATACGGCGCAGCGCGCGAAAAACTCC
ACGGTCTATTTCACGCAAAAACTGTTTACCCACATCATTTATCCTGAAGCGGGTTTAGCGTCGGATAATT
TCCGGGTTGCAAAAAACAAACGCCGTTTGATGGGGCTCTCTTTTGTCGCATGCTCAGTGGCGACTTTGCT
GTTGGCGGGAACTTGGCATCGTAACTACCTCAATAACGTGCAACACGCCGATACTGTATTAACCAAAGTG
AATCAGTATAAAGAGCAGTTCCCGACCAGCCGTTCATTGGCCTCACAAAGAGAGGTATTGGATCCGTTGA
ACAAGATCCGTGAGGCGACACTGGAGTTTGGTTTCTTCCGTGATAAACCTCAGTACATCTCCGATTTTGG
TCTCTACCAAGGGCACACCATTGGCCCGAAAGTAGAAGAGACCTACTTAAACTTACTCGAAACTCGCTTC
TTGCCTCTGTTGATGGCGGACACCATTGTTGCGCTCAATCAAGCTGAGACAGATGAAGAAAAATTAGCGG
TGCTGCGTGTGTATCGCATGCTGGTCGATAAAAGTGGTCGTTACCAAGACTATGTGATGGATTATTTTGC
GAAGTATTGGCAAAAATCCTTCTCAGGTCAGCGTCAAATTCAGGAAGAGCTGCTCGGCCACTTAGATTAC
GCGATGCGTCATACGGACCTCACTGCAGAGAGGCTCAATGGTGATAAAGGGGCGGAGCAGGTGATGCGCC
CTTACGATAAAGTGATTGCTCGTGCTCAGGTTGAACTGGGTTCAATGCCAAACGACCAGCGCGTCTATCG
TAACTTGAAATTGAGCGCACAAACGGTGCTTGGTCCTTCGGTTAACTTGCGTAGCTTGATTGGGCCGGTG
TTCGATGTGGTGTTTGAAGAGCGCGTTCTTAACAGTAGCAGCCTGTTTATTCCTCAAATGCTCACCAAGC
GTGGTTTTGATGACTACTTTATGCCGCAATCTGAATCGGTCTCTGAGCTGGCACTGATTGACAGTTGGGT
TCTGGGACAGAGCAAAACGGCACAGTTTAGTGAAGCAGACAAGCAGGCACTGCGCGAAAAAATCCGCGAT
CTTTATGTGGCGGATTACACCAACACATGGCGCGCGGCACTCAATGAAATTGATGTGAAGTATTTCAATG
ACATCAATGATGCGGTCATGGTTTTGGAAAATATCACCAGTAACCTTGAGCCGATGCAGCGTCTACTGCG
CACATTAGATGACAACACCCAACTGTACAGTGCGTTACCTAAAGATGAATCGGCGTTAAAAGAGCTGCTG
AAAAGTCCGAAATACAAAGTGGCTTCGATGATTGAAACTCCGTTTGCTGATCTGAACGGTATGCTCAAAC
CGGTGGGCAGCAAACCAGCGTACATGACGGAAGTCTTGGCTTCGGTGGATGAGCTGAAAAGCTACTTGAA
ATCGATTCAAGATGCTCCCGATGTCGGTATGGCGGCGCTCGATGCGACCAAAGCGCGGGTCAAACTGGTT
AATGCTGACCCTATCTATACCTTAAAACGTATCTCGTCAGGACTGCCGAAGCCGCTGGATAGCATGATGG
CAAAGCTTGCAGATGAGAGCTGGTATGTGGTCAAGCAAGAAGCGATCAAGCATCTGGAAGTTCGCTGGAC
GGAGGATGTGTATAAAACCTTCCAAAGCAAGCTGGCTGGGCGTTATCCATTCAACCCCGCATCAAATAAA
GATGTTGCCTTGGCCGATTTTGAAGCCTTCTTTGCGCCGAATGGCACGTTAGACAACTTCTACAATCAGC
AACTGAAGATGTTTATTGATGAGAACATCAGCGTCGCGTCGGATGACTCAGCGCAGTCGATCATTCGTAA
AGAAGTGCTGGATCAGATCAAGCAAGCGCAGAAAATTCGTGAGGCTTTCTTCAACCGTAAAGGGATTTTG
GATGTCAGCTTCTCGGTTGAGCCGCTCAGTTTGAGTAACAACAAGCGTCGTAGTGTGCTGAATGTGGATG
GTCAGTTCTTAGCTTACAGCCATGGTCCGCGTGAAAATGTGGAGCTGATTTGGCCTAACACGCTGCGTGA
TTCTGCGGTGTCTAAGGTGACCTTGATTCCAACCCAAACCAATATGTCACCGCGCAGTTTGCAAATCCAA
GGACCGTGGGCATTCTTCCGCTTATTGGATCAAGGTGATGTGGTTTCGGCGAGTCAAACGTCGGTTGATT
TCAAATTTATCGTCGATGGCGGTGAGATGATCTACCGTATTAACGCAGAGGCCGATGCCAACCCATTTAC
CGAACGCCTGTTCAAGTCGTTCAAACTGTCTAAAACACTCTATTAA
 Primer design