SecReT6
Protein ID: 229590985
SecReT6 ID786
T6SS typei1
Gene symbol-
Locus tagPFLU3542
StrainPseudomonas fluorescens SBW25
Repliconchromosome [GenBank: NC_012660] [Browse all T6SS(s) in this replicon]
Location [Strand]3928428..3929273 [-]
Productputative serine/threonine-protein kinase
NoteStk1
UniProt IDC3K7U2
KEGG IDpfs:PFLU3542
PDB IDNA
Domain hit(s) vs Pfam Pkinase [PF00069], Evalue: 2.50E-34, Aligned region: 15..232
Pkinase_Tyr [PF07714], Evalue: 3.40E-21, Aligned region: 16..235
APH [PF01636], Evalue: 1.00E-05, Aligned region: 93..167
APH [PF01636], Evalue: 1.00E-05, Aligned region: 219..228
Protein Sequence: 281 a.a.     [Download]
>gi|229590985|ref|YP_002873104.1| putative serine/threonine-protein kinase [Pseudomonas fluorescens SBW25]
MNAAAGPPSLLAGRYQLERILGSGGMGVVYRARDLLHEAFGEPDCRVALKLLGETLSACTDAHLLLYSEF
ALTRSLRHDHVVRAFSFEVDTAHQVAFFTMEVMPGLTLDRMLPERPQGLPWQELQPMAVQLLDALAYTHR
QGVLHGDVKPANIMVGEQGVRLFDFGLGHAEAQVGVGLPGLSRSRLNAWTPAYAAPELMAGGLPSASADL
YGVACVLYELAEGRRPGERQRNQRLPRPRQLPRHCWPTLCAALAMDPEQRRVCVAELREVLGGRRRRWFL
G
 
Nucleotide Sequence: 846 bp     [Download]
>ref|NC_012660.1|:c3929273-3928428 putative serine/threonine-protein kinase [Pseudomonas fluorescens SBW25]
ATGAACGCAGCAGCGGGCCCGCCGAGCCTGCTTGCGGGCCGCTATCAGCTTGAACGGATCCTCGGTTCAG
GCGGGATGGGCGTGGTGTATCGCGCCCGGGACCTGCTGCATGAAGCGTTCGGCGAGCCGGACTGCCGTGT
GGCGCTGAAGCTGTTGGGCGAGACACTCTCCGCGTGCACCGATGCGCATTTATTGTTGTACAGCGAGTTC
GCCCTGACCCGCAGCCTGCGCCATGACCACGTGGTGCGCGCATTTTCTTTCGAGGTAGACACGGCCCACC
AAGTGGCATTCTTCACCATGGAAGTGATGCCCGGCCTGACCCTCGACCGCATGCTCCCGGAACGCCCGCA
AGGCCTGCCGTGGCAGGAGCTGCAACCGATGGCCGTGCAATTGCTGGATGCGCTGGCTTACACGCATCGG
CAAGGCGTCCTGCATGGCGATGTGAAACCGGCGAATATCATGGTGGGGGAGCAGGGGGTGCGCTTGTTTG
ATTTTGGCCTGGGCCATGCCGAGGCACAGGTAGGGGTTGGTTTACCGGGTTTGAGCCGCAGTCGCTTGAA
TGCCTGGACGCCTGCGTATGCGGCACCGGAGCTGATGGCCGGAGGGTTGCCGTCAGCCAGCGCGGACCTG
TATGGGGTTGCGTGTGTGTTGTATGAGCTGGCCGAGGGACGGCGTCCCGGCGAGCGCCAGCGCAATCAGC
GGTTGCCGAGACCTCGGCAACTGCCCAGGCATTGCTGGCCAACGTTGTGCGCCGCACTGGCGATGGACCC
GGAGCAGCGAAGGGTATGTGTCGCCGAGTTGCGCGAAGTCCTGGGCGGCAGGCGACGTCGCTGGTTCCTG
GGGTAA
 Primer design