SecReT6
Protein ID: 229590986
SecReT6 ID786
T6SS typei1
Gene symbol-
Locus tagPFLU3543
StrainPseudomonas fluorescens SBW25
Repliconchromosome [GenBank: NC_012660] [Browse all T6SS(s) in this replicon]
Location [Strand]3929270..3929983 [-]
Productputative protein phosphatase
NoteStp1
UniProt IDC3K7U3
KEGG IDpfs:PFLU3543
PDB IDNA
Domain hit(s) vs Pfam PP2C [PF00481], Evalue: 6.10E-16, Aligned region: 34..229
PP2C_2 [PF13672], Evalue: 2.00E-15, Aligned region: 11..209
SpoIIE [PF07228], Evalue: 1.60E-08, Aligned region: 36..236
Protein Sequence: 237 a.a.     [Download]
>gi|229590986|ref|YP_002873105.1| putative protein phosphatase [Pseudomonas fluorescens SBW25]
MNRALRWRSAGRTAQGKGRARNEDAWLDCPQHGCWAVADGMGGHRAGNVASQRVVSSLAALPAHGGFEQR
IDAVRRCLRDLDSQLQAADGLAGIMGSTVVVLLLEHDRAACIWAGDSRCYLWRSQCLYQLSRDHSLQQQL
MDKQQLSLERARAHPDARALTRAIGARQPLSLEILEFCAHPGDVFLLCSDGLYQGLSHSELGSAMSAGTP
RKVVERLFSDALRAAAKDDLTAVVVQP
 
Nucleotide Sequence: 714 bp     [Download]
>ref|NC_012660.1|:c3929983-3929270 putative protein phosphatase [Pseudomonas fluorescens SBW25]
GTGAACCGGGCGCTGCGTTGGCGAAGTGCAGGGCGCACGGCGCAAGGCAAGGGCCGTGCGCGCAACGAGG
ATGCATGGCTTGATTGCCCGCAACACGGGTGTTGGGCGGTCGCCGATGGCATGGGCGGCCATCGTGCCGG
GAATGTGGCCAGTCAACGGGTGGTCAGCAGTCTTGCCGCACTGCCAGCCCATGGGGGCTTCGAGCAACGG
ATCGACGCGGTGCGACGCTGCTTGCGCGACCTCGACAGCCAATTGCAAGCCGCCGATGGCCTGGCGGGCA
TCATGGGCAGTACGGTGGTTGTACTGTTACTTGAACACGACCGTGCAGCCTGTATCTGGGCAGGTGATAG
TCGATGCTACCTCTGGCGCAGTCAGTGCCTGTATCAACTGTCGCGCGACCACTCTTTGCAGCAACAACTG
ATGGATAAGCAGCAACTGAGCCTGGAACGCGCTCGGGCTCATCCGGACGCCAGGGCCCTCACACGCGCCA
TTGGTGCCCGACAGCCACTGAGCCTCGAGATACTGGAGTTCTGTGCCCATCCAGGGGATGTGTTTTTACT
CTGCAGTGATGGCCTGTATCAGGGGCTCAGCCACAGTGAGCTGGGGAGCGCCATGAGTGCGGGTACGCCG
CGCAAGGTGGTGGAGCGCTTGTTCAGCGACGCGTTGCGGGCGGCGGCGAAAGATGACCTGACCGCCGTGG
TGGTCCAGCCATGA
 Primer design