SecReT6
Protein ID: 229590987
SecReT6 ID786
T6SS typei1
Gene symbol-
Locus tagPFLU3544
StrainPseudomonas fluorescens SBW25
Repliconchromosome [GenBank: NC_012660] [Browse all T6SS(s) in this replicon]
Location [Strand]3929980..3932268 [-]
Producthypothetical protein
NoteTssM
UniProt IDC3K7U4
KEGG IDpfs:PFLU3544
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 7.80E-55, Aligned region: 74..116
ImcF-related_N [PF14331], Evalue: 7.80E-55, Aligned region: 190..401
DUF1215 [PF06744], Evalue: 1.90E-38, Aligned region: 497..621
AAA_16 [PF13191], Evalue: 0.0029, Aligned region: 128..268
AAA_16 [PF13191], Evalue: 0.0029, Aligned region: 300..315
AAA_16 [PF13191], Evalue: 0.0029, Aligned region: 415..444
DUF4131 [PF13567], Evalue: 0.0037, Aligned region: 14..96
Protein Sequence: 762 a.a.     [Download]
>gi|229590987|ref|YP_002873106.1| hypothetical protein PFLU3544 [Pseudomonas fluorescens SBW25]
MNAFFKGAGAVLRKSWVWSLLLVLSSTLLVWFLGPLLAVDDYRFWQSPTSRLLTICGLLLLWGLAMVVVG
ARRSARADQPEHLDRHQRQALVNNEISHVRGRFKEALLTLKTSRRYGEHRQGWRNELPWYLLIGERSSGK
TSLLAASGLQAPLDRTEAAFPGTAAYCDWYFADEAVMVEMAGRYLDQPDPAVDGAGWSTLLGLLKAWRRT
RPLNGVVVTLCVDTLLRSSEHDLELHARHVRTRLQDIQQTLHVDVPVYLVLTQADRLAGFAEFFDALQGD
STEDVLGERLVAGPAGTDIEQVREAFEALLQRLGAELIPRLHQERNLERRGRMLDFPRQVARLGDCLCVF
IEAAFSAHRHQRINGLRGFYLTGAKSGDVRPHFVQGLFNRVVFAQLGTVSQQVAESSEKVSGALAKALPR
QALPDNARRALQRRFEPLHQLLDEEQNPGVELTQALRLLDELYLQLSTLSRDSSPEQAAFKLARQRMDGQ
QPLLGNLRDAAARLPQPLRGWFEGIAEQSWRHLLDNAYGYVNQRYQSEVYGFYTKAIQHRYPFNAHAGSD
VALDDFQAFFKPKGAMERFYDGYLRPFVSVEGTRYRLRALEGRSLPMSRSLLDQLTRAQTIRQGFFNEER
GDWAVRFTLAPYSLDQAVSRATLQVGSQQLEYRHGPIVPMVFHWPNASGNGRTSLVLERGAERPLGIEKD
SGTWSLFRFFELMQSEPASGRDAQILKADLAGLRANYLLTSQGNPSPFQIATWRTFRLPEQL
 
Nucleotide Sequence: 2289 bp     [Download]
>ref|NC_012660.1|:c3932268-3929980 hypothetical protein PFLU3544 [Pseudomonas fluorescens SBW25]
ATGAACGCATTCTTCAAGGGCGCGGGCGCGGTGCTGCGCAAGAGTTGGGTCTGGAGCCTGTTACTGGTGC
TCTCGAGTACGCTGTTGGTGTGGTTTTTGGGGCCTTTGCTGGCGGTGGATGACTACCGTTTCTGGCAAAG
CCCGACCTCCCGTTTGCTGACCATCTGCGGGTTGTTGCTGCTGTGGGGGCTGGCGATGGTCGTGGTGGGC
GCACGCCGCTCCGCTCGGGCGGATCAGCCTGAACACCTCGACCGTCATCAGCGGCAGGCGTTGGTCAACA
ACGAAATAAGCCACGTACGGGGGCGTTTCAAGGAGGCCCTGCTGACGTTGAAGACCTCTCGTCGCTACGG
TGAGCACCGTCAGGGCTGGCGCAATGAACTGCCCTGGTACCTGTTGATTGGCGAGCGGAGCAGCGGCAAG
ACCTCGTTGTTGGCCGCCAGTGGCCTGCAGGCTCCGCTCGATCGGACCGAAGCGGCGTTCCCAGGTACTG
CGGCTTACTGTGACTGGTATTTTGCCGACGAAGCCGTGATGGTCGAGATGGCCGGCCGCTACCTGGACCA
GCCTGACCCCGCGGTAGATGGGGCGGGATGGTCGACATTGCTGGGCCTGCTCAAGGCGTGGCGCAGAACA
CGGCCGCTCAATGGCGTGGTGGTGACGCTGTGCGTCGACACGCTTTTGCGCAGCAGTGAACACGACCTGG
AGCTTCACGCGCGTCACGTGCGTACCCGCTTGCAGGATATCCAGCAGACACTGCATGTGGATGTGCCGGT
TTACCTGGTATTGACCCAGGCTGATCGGCTGGCTGGGTTTGCCGAGTTCTTTGATGCGCTGCAGGGCGAC
AGCACCGAAGATGTGCTGGGTGAGCGCCTGGTTGCAGGCCCGGCCGGCACTGATATTGAGCAGGTGCGCG
AGGCATTCGAAGCCCTGCTGCAACGCCTGGGAGCCGAGTTGATCCCGCGCTTGCACCAGGAGCGAAACCT
TGAGCGCCGTGGCCGGATGCTGGATTTTCCTCGGCAGGTTGCACGCCTCGGCGACTGTCTGTGCGTGTTT
ATCGAGGCTGCGTTTTCCGCCCATCGCCATCAGCGTATCAACGGTTTGCGAGGGTTCTACCTGACCGGTG
CGAAGAGCGGCGATGTACGTCCCCATTTTGTCCAGGGCCTGTTCAATCGCGTGGTTTTCGCGCAACTGGG
TACGGTGAGCCAACAGGTCGCAGAGTCAAGCGAGAAGGTATCCGGCGCGCTGGCCAAGGCGTTACCGCGC
CAAGCGTTGCCCGATAATGCCCGGCGCGCGTTGCAACGCCGCTTCGAGCCTCTGCATCAGTTGCTCGATG
AAGAGCAGAACCCCGGGGTCGAGTTGACGCAGGCATTGCGCCTGCTCGATGAGCTGTACCTGCAATTGTC
GACACTGAGCCGGGACAGTTCACCGGAGCAGGCCGCGTTCAAGCTGGCCAGGCAGCGGATGGATGGGCAG
CAGCCGCTATTGGGCAACCTGCGTGATGCGGCAGCGCGCTTGCCGCAACCACTCAGGGGGTGGTTCGAAG
GTATTGCCGAGCAAAGCTGGCGCCACCTGCTTGATAACGCCTATGGGTACGTGAATCAGCGTTATCAAAG
CGAGGTGTACGGCTTTTATACGAAGGCGATCCAACACCGCTACCCGTTCAACGCCCATGCTGGCAGCGAT
GTCGCCCTGGACGATTTCCAGGCGTTCTTCAAACCGAAGGGGGCCATGGAGCGTTTTTATGACGGTTATC
TGCGGCCGTTTGTCAGTGTCGAGGGCACCCGCTATCGCTTGCGCGCCCTGGAGGGGCGCAGCTTGCCGAT
GTCACGTTCGTTGCTGGACCAACTGACCAGGGCCCAGACCATTCGCCAAGGTTTTTTCAACGAGGAGCGG
GGTGATTGGGCCGTCAGGTTTACGCTGGCGCCCTATAGCCTGGATCAAGCCGTCAGCCGGGCAACGTTGC
AGGTGGGCAGTCAGCAGTTGGAGTACCGGCATGGCCCGATCGTGCCGATGGTGTTCCATTGGCCGAACGC
GTCCGGAAATGGGCGCACCAGCTTGGTGCTGGAACGCGGCGCCGAGCGGCCATTGGGCATCGAAAAAGAC
AGTGGCACCTGGTCGTTGTTCCGGTTCTTCGAGCTGATGCAAAGCGAGCCTGCCAGCGGCAGGGACGCGC
AGATACTCAAGGCCGACCTGGCTGGCCTCCGTGCTAATTACCTGCTCACCAGCCAGGGTAACCCCAGCCC
TTTCCAGATCGCGACATGGCGCACCTTCCGCCTGCCGGAGCAATTGTGA
 Primer design