SecReT6
Protein ID: 229593375
SecReT6 ID482
T6SS typei3
Gene symbol-
Locus tagPFLU6010
StrainPseudomonas fluorescens SBW25
Repliconchromosome [GenBank: NC_012660] [Browse all T6SS(s) in this replicon]
Location [Strand]6566154..6569129 [-]
Productputative serine/threonine protein kinase
NotePpkA
UniProt IDC3K498
KEGG IDpfs:PFLU6010
PDB IDNA
Domain hit(s) vs Pfam Pkinase [PF00069], Evalue: 1.90E-49, Aligned region: 8..250
Pkinase_Tyr [PF07714], Evalue: 2.20E-33, Aligned region: 11..248
VWA_2 [PF13519], Evalue: 8.20E-10, Aligned region: 129..144
VWA_2 [PF13519], Evalue: 8.20E-10, Aligned region: 250..264
VWA_2 [PF13519], Evalue: 8.20E-10, Aligned region: 574..753
VWA_2 [PF13519], Evalue: 8.20E-10, Aligned region: 830..883
APH [PF01636], Evalue: 1.60E-06, Aligned region: 14..121
APH [PF01636], Evalue: 1.60E-06, Aligned region: 120..150
APH [PF01636], Evalue: 1.60E-06, Aligned region: 236..268
Kinase-like [PF14531], Evalue: 0.00055, Aligned region: 119..210
Protein Sequence: 991 a.a.     [Download]
>gi|229593375|ref|YP_002875494.1| putative serine/threonine protein kinase [Pseudomonas fluorescens SBW25]
MNIVIPGYDIEGEIGEGAMASVYLATQRSLERKVALKVMAAALAADPSFCERFLREGKTLARLSHPHTVT
IHDIGNVGELYYMAMEYLPNGTLKERIAAGLTPEQGVTLIRQIASALGYAHAQGLVHRDVKPANILFRAD
GTAVLSDFGIAKSLDDRTQFTQAGFAVGTPSYMSPEQARGQEIDGRADLYALGVVLYEILVGKLPYSGTD
ALSTALAHLTEPLPELPVHHGRYQEVLRKLLAKDPAERFPDAAALLQALDNLPAESPEATLVRPLPIPLS
FDLAGMTPVTIDIPTDKPQPQPVARQPVVTPTQHNAVSEQRRGPVMALAAVAVAVALAIGGASYWWLSGS
DKPVAKPPAAVVPTVAPPVPDVDGGQRPLLMAGKKTLFQRVLSKPGAKLSSDAGSAPGKALPAFSVLYVY
QRKDVDGSPWVRVGAATDGRSDGWLPASHVSDWKQSLVLKFTERSGRAPVMFLRQSGEVEKLLADPAAAK
GVLAKAQKNSEDNSQILALEPTASAVPQNQFYLLPIFDSKETFDENGQPVQLLNVASIDPGSSAAAKPST
PVIKANADAFRTAVVLVVDTTVSMQPYIDQIRDVVHELQTRIAERGELDSVSFGMVGFRSSIKKTPGLEY
VAKTLISLDQGRDPQRFLDMARQVKASTVSSHSFNEDAFAGVMQAVDGMDWSGYGGRIILLVTDAGALRK
NDPFAATQMNEAEVRQAALGKQIKIYALHLRTDAGKKTHAGAESQYRILTADANPQIGDLYTPVPGGDVR
KLGERVDEIGTVFANLVHQVRSNTPQPVPLLSSAPTLADKSAAVGYAMHMDFLGRKAASQAPQLVSAWTA
DRDLTNPALPAFQVCVMLTKLQLNDLQQSLKLIVDAARKTQTSPKDFFQEIASASAYMSRDPQALRKGGN
LADGGILGEYLEGLPYRSKSLNMTQDLWLSLSVAEQEDFIDELDSKIRLYETFHNDVANWVRFGDAEPGD
ALYRVPLSTLP
 
Nucleotide Sequence: 2976 bp     [Download]
>ref|NC_012660.1|:c6569129-6566154 putative serine/threonine protein kinase [Pseudomonas fluorescens SBW25]
ATGAACATCGTCATCCCCGGCTACGACATCGAAGGCGAGATCGGCGAAGGCGCCATGGCCAGCGTGTACC
TGGCGACCCAGCGCTCGCTGGAGCGCAAGGTGGCGTTGAAGGTGATGGCGGCGGCGCTGGCGGCCGACCC
GAGCTTCTGCGAACGCTTCCTGCGCGAGGGTAAGACCCTGGCGCGCTTGTCGCACCCGCACACGGTGACC
ATCCATGACATCGGCAACGTCGGTGAGCTGTATTACATGGCCATGGAATACCTGCCCAACGGTACGCTCA
AGGAGCGCATCGCCGCAGGGTTGACGCCGGAGCAGGGTGTGACGCTGATTCGCCAGATCGCCTCGGCGCT
GGGCTATGCCCATGCCCAAGGGCTGGTGCACCGCGATGTGAAACCGGCGAACATTCTGTTTCGCGCTGAT
GGCACGGCGGTGCTGTCCGACTTTGGTATCGCCAAGTCGCTGGACGACCGCACCCAGTTCACCCAGGCCG
GGTTTGCCGTGGGCACGCCGAGCTACATGAGCCCGGAACAGGCGCGGGGCCAGGAGATCGACGGCCGTGC
CGACCTGTACGCGTTGGGTGTGGTGCTGTATGAAATTCTCGTCGGCAAGCTGCCGTATAGCGGCACCGAC
GCGCTGTCCACGGCATTGGCGCACCTGACTGAGCCATTGCCGGAACTGCCGGTGCACCACGGTCGCTACC
AGGAGGTGCTGCGCAAGCTGTTGGCCAAGGACCCGGCGGAACGGTTCCCGGATGCAGCGGCGTTGTTGCA
GGCCCTGGATAACCTGCCGGCGGAGTCGCCGGAGGCCACCTTGGTGCGGCCGCTGCCCATCCCGCTGAGC
TTCGACCTGGCGGGCATGACCCCGGTCACTATCGATATTCCGACCGATAAACCACAGCCGCAACCTGTCG
CGCGCCAGCCGGTGGTGACACCGACGCAACACAACGCCGTGTCCGAGCAGCGCCGTGGGCCGGTGATGGC
GCTGGCGGCGGTTGCGGTGGCGGTGGCCTTGGCCATCGGTGGTGCCAGTTACTGGTGGTTGAGCGGTAGC
GATAAGCCCGTCGCCAAGCCGCCGGCTGCGGTGGTGCCGACGGTGGCGCCGCCTGTTCCCGACGTCGACG
GCGGCCAGCGTCCGTTATTGATGGCAGGTAAGAAGACACTGTTCCAGCGCGTCCTGAGTAAGCCGGGCGC
CAAGCTTTCCTCTGACGCAGGCAGCGCGCCGGGCAAAGCCCTGCCGGCGTTTTCCGTGCTCTATGTCTAC
CAACGCAAGGACGTCGACGGCAGCCCGTGGGTACGCGTCGGTGCCGCCACCGATGGGCGCAGCGACGGTT
GGTTGCCGGCGTCACACGTCAGCGACTGGAAACAGAGCCTGGTGCTCAAGTTCACCGAACGTTCGGGCCG
GGCGCCCGTGATGTTCCTGCGCCAATCCGGCGAAGTAGAGAAGTTGTTGGCCGACCCAGCCGCCGCCAAA
GGCGTGCTGGCCAAGGCGCAGAAAAACAGCGAAGACAACAGCCAGATACTGGCCCTGGAACCGACGGCCA
GCGCGGTGCCGCAGAATCAGTTCTACCTGTTGCCGATCTTCGATTCCAAAGAGACCTTTGACGAAAACGG
CCAGCCGGTGCAGTTGCTCAATGTGGCCTCCATCGACCCCGGCAGCAGCGCAGCCGCCAAGCCCTCGACG
CCGGTGATCAAGGCCAACGCCGATGCCTTCCGTACCGCCGTGGTGTTGGTGGTCGACACCACCGTGTCGA
TGCAGCCCTACATCGACCAGATTCGCGACGTGGTGCACGAACTGCAAACCCGCATCGCCGAGCGTGGCGA
GTTGGACAGTGTCAGTTTCGGCATGGTGGGCTTTCGCAGCAGTATCAAGAAAACCCCAGGCCTGGAGTAC
GTGGCCAAGACCCTGATCAGCCTCGACCAGGGCCGCGACCCGCAACGCTTCCTCGACATGGCGCGCCAGG
TCAAGGCGTCCACGGTGTCCAGCCACTCGTTCAACGAAGACGCGTTCGCCGGGGTGATGCAGGCGGTGGA
TGGCATGGATTGGTCCGGCTACGGCGGGCGCATTATCCTGCTGGTTACCGACGCTGGCGCGCTGCGCAAG
AACGACCCGTTTGCCGCCACCCAGATGAACGAAGCCGAAGTGCGCCAGGCGGCGCTGGGCAAGCAGATCA
AGATCTACGCCCTGCACCTGCGCACCGACGCCGGCAAGAAAACCCATGCCGGTGCCGAGAGCCAGTACCG
CATCCTTACCGCCGACGCCAACCCGCAGATCGGCGACCTCTACACGCCGGTGCCGGGTGGCGACGTGCGT
AAATTGGGCGAGCGTGTGGACGAAATCGGCACGGTGTTCGCCAACCTTGTTCATCAGGTACGCAGCAATA
CGCCGCAGCCAGTGCCGTTGTTGAGTTCCGCGCCAACCTTGGCGGATAAATCCGCAGCCGTCGGCTACGC
CATGCACATGGATTTCCTCGGTCGCAAAGCCGCGAGCCAGGCGCCGCAACTGGTCAGCGCCTGGACCGCC
GACCGCGACCTGACCAACCCGGCACTGCCGGCGTTCCAGGTCTGCGTGATGCTGACCAAATTGCAGCTCA
ACGACCTGCAACAGTCGTTGAAACTGATCGTCGACGCGGCGCGCAAGACCCAGACTTCGCCCAAGGACTT
CTTCCAGGAAATCGCCAGCGCCTCTGCCTACATGAGCCGCGACCCGCAGGCCCTGCGCAAGGGCGGCAAC
CTGGCCGACGGCGGCATTCTTGGCGAATACCTGGAAGGCCTGCCGTACCGCAGCAAGTCGCTGAACATGA
CCCAGGACTTGTGGTTGTCGTTGAGCGTGGCCGAGCAGGAAGACTTTATCGACGAGCTGGATTCGAAGAT
CCGCCTCTATGAAACCTTCCACAATGACGTGGCCAACTGGGTCCGTTTCGGCGATGCCGAGCCGGGCGAC
GCGTTGTACCGCGTGCCGCTGTCGACGTTGCCGTGA
 Primer design