SecReT6
Protein ID: 229593376
SecReT6 ID482
T6SS typei3
Gene symbol-
Locus tagPFLU6011
StrainPseudomonas fluorescens SBW25
Repliconchromosome [GenBank: NC_012660] [Browse all T6SS(s) in this replicon]
Location [Strand]6569126..6569845 [-]
Productputative phosphatase
NotePppA
UniProt IDC3K499
KEGG IDpfs:PFLU6011
PDB IDNA
Domain hit(s) vs Pfam PP2C_2 [PF13672], Evalue: 6.10E-12, Aligned region: 16..201
PP2C [PF00481], Evalue: 2.20E-11, Aligned region: 25..230
SpoIIE [PF07228], Evalue: 4.60E-05, Aligned region: 33..237
Protein Sequence: 239 a.a.     [Download]
>gi|229593376|ref|YP_002875495.1| putative phosphatase [Pseudomonas fluorescens SBW25]
MGSTYKSASKSHVGMVRQVNEDACLDLPENRLWVVADGMGGHAAGDYVSSLIVDSLRSVPVGRSLDEYTA
ALRNDLIRINAAVREETAHRGVSMMGSTVVLLAARGLRGVCLWAGDSRLYRLRDGVLEGISRDHSYVQDL
QDSGLLSEADARVHPRANIVTRAIGVEAHLDLAVVDLLIAPGDSYLLCSDGLNKTVEDHEIREVLSHDAP
DEIVRSLVHLGLNRGAPDNITAIVVKVSP
 
Nucleotide Sequence: 720 bp     [Download]
>ref|NC_012660.1|:c6569845-6569126 putative phosphatase [Pseudomonas fluorescens SBW25]
ATGGGGTCGACGTACAAATCCGCAAGCAAAAGCCATGTGGGCATGGTCCGCCAGGTCAACGAAGACGCCT
GCCTGGACCTGCCGGAAAATCGTCTGTGGGTGGTGGCCGACGGCATGGGCGGGCATGCGGCGGGGGACTA
TGTGAGCAGCCTGATCGTCGACAGCCTGCGCAGCGTGCCGGTGGGGCGCTCGCTGGATGAATACACGGCG
GCGCTGCGCAACGACCTGATCCGCATCAACGCAGCCGTGCGCGAAGAAACCGCCCACCGTGGCGTGTCCA
TGATGGGCAGTACCGTAGTGTTGTTGGCCGCCCGAGGCCTGCGCGGCGTGTGCCTGTGGGCCGGCGACAG
TCGCTTGTACCGCTTGCGCGACGGTGTGCTCGAAGGCATCTCACGCGACCACAGCTACGTCCAGGACCTG
CAAGACAGCGGCCTGCTCAGCGAAGCCGACGCCCGCGTCCACCCACGCGCCAATATCGTCACCCGCGCCA
TTGGCGTGGAGGCGCACTTGGACCTGGCGGTGGTCGACCTGCTGATCGCCCCCGGTGACAGCTACCTGCT
GTGCAGCGACGGCTTGAACAAGACCGTCGAAGACCATGAGATCCGCGAAGTGCTCAGCCATGACGCACCG
GATGAAATCGTGCGCAGCCTGGTGCACCTGGGGCTCAACCGGGGCGCGCCGGACAACATCACCGCCATCG
TCGTGAAGGTATCGCCATGA
 Primer design