SecReT6
Protein ID: 229593377
SecReT6 ID482
T6SS typei3
Gene symbol-
Locus tagPFLU6012
StrainPseudomonas fluorescens SBW25
Repliconchromosome [GenBank: NC_012660] [Browse all T6SS(s) in this replicon]
Location [Strand]6569846..6570499 [-]
Producthypothetical protein
NoteTagF
UniProt IDC3K4A0
KEGG IDpfs:PFLU6012
PDB IDNA
Domain hit(s) vs Pfam DUF2094 [PF09867], Evalue: 1.30E-48, Aligned region: 5..141
DUF2094 [PF09867], Evalue: 1.30E-48, Aligned region: 200..208
Protein Sequence: 217 a.a.     [Download]
>gi|229593377|ref|YP_002875496.1| hypothetical protein PFLU6012 [Pseudomonas fluorescens SBW25]
MTALGFYGKLASRGDFVSRALPQSFIGPWDSWLAAGLLASQNSLGGDWLNTYLVSPLWRFVLAPGVCGPD
AAAGVVMPSIDRVGRYFPLAVVALLDHATNPASLVGGPDSWFEQAEALLLSTLDTGATFERFNDGLDSLG
FPASELRAQDSRFAGLQRVAATEPHQRMTALAELACDGASLWWGRGSQAISPGLLRCQGLPAASDFAQFL
LGQEGVV
 
Nucleotide Sequence: 654 bp     [Download]
>ref|NC_012660.1|:c6570499-6569846 hypothetical protein PFLU6012 [Pseudomonas fluorescens SBW25]
ATGACGGCGCTGGGTTTCTACGGCAAGTTGGCCAGCCGCGGTGATTTTGTCAGCCGCGCCTTGCCCCAGA
GTTTTATCGGCCCGTGGGACAGCTGGCTGGCGGCGGGTTTGCTTGCCAGCCAAAACAGCCTCGGCGGTGA
TTGGCTCAACACGTACTTGGTCAGCCCGCTGTGGCGCTTTGTGCTGGCGCCCGGCGTGTGTGGGCCGGAC
GCGGCGGCGGGCGTGGTGATGCCGAGCATCGATCGGGTCGGCCGCTACTTTCCGCTGGCGGTGGTGGCGT
TGCTCGATCACGCCACCAACCCGGCCTCGCTGGTGGGCGGGCCGGACAGCTGGTTCGAGCAGGCCGAAGC
GCTGTTGCTCAGCACCCTGGATACCGGTGCCACCTTCGAACGCTTCAATGACGGTCTCGATAGCCTGGGT
TTCCCGGCGAGCGAGCTACGCGCGCAGGACAGCCGTTTCGCCGGTCTGCAGCGGGTGGCCGCCACCGAAC
CGCACCAGCGCATGACCGCGCTCGCCGAACTGGCCTGCGACGGCGCGAGCCTGTGGTGGGGCCGGGGCTC
GCAGGCGATTTCCCCAGGTTTGTTGCGGTGTCAGGGCCTACCCGCCGCCAGCGATTTTGCGCAGTTTTTG
CTCGGACAAGAAGGTGTGGTGTAG
 Primer design