SecReT6
Protein ID: 229593378
SecReT6 ID482
T6SS typei3
Gene symbol-
Locus tagPFLU6013
StrainPseudomonas fluorescens SBW25
Repliconchromosome [GenBank: NC_012660] [Browse all T6SS(s) in this replicon]
Location [Strand]6570496..6573996 [-]
Producthypothetical protein
NoteTssM
UniProt IDC3K4A1
KEGG IDpfs:PFLU6013
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 3.50E-97, Aligned region: 71..122
ImcF-related_N [PF14331], Evalue: 3.50E-97, Aligned region: 188..450
IcmF-related [PF06761], Evalue: 2.40E-89, Aligned region: 499..794
DUF1215 [PF06744], Evalue: 1.40E-40, Aligned region: 689..724
DUF1215 [PF06744], Evalue: 1.40E-40, Aligned region: 904..1025
AAA_19 [PF13245], Evalue: 0.0048, Aligned region: 124..141
AAA_16 [PF13191], Evalue: 0.0054, Aligned region: 122..250
AAA_16 [PF13191], Evalue: 0.0054, Aligned region: 405..420
AAA_16 [PF13191], Evalue: 0.0054, Aligned region: 618..640
AAA_16 [PF13191], Evalue: 0.0054, Aligned region: 772..801
Protein Sequence: 1166 a.a.     [Download]
>gi|229593378|ref|YP_002875497.1| hypothetical protein PFLU6013 [Pseudomonas fluorescens SBW25]
MKAFFSFMIRWVIPVLGLIALSLIIWFVGPLLDVLVPEGRRWALIILVFAVWIAYRVFRIIQARRQAAEV
MRSLAAQTPADPNSTATAEELTTLRQRMDEALALLKKAKLGGDERRNLYELPWYVIIGPPGSGKTTALVN
SGLHFPLAAQLGAGAVRGVGGTRNCDWWFTDQAVLLDTAGRYTTQDSNSTVDKAAWLGFLDLLKKQRSRR
PIDGAFIAISLSDLLLGTDPERAAHAAAIRLRIQELYTQLGVRFPIYLMLTKLDLVPGFMEFFDNLSKEE
RAQVWGMTFALDDGKNTDSPLAHLQSEFAGLEQRLNERLVERLQQERDPARRDLIYGFPQQFGALKDCLQ
SFLEGVFKPNAFEERVLLRGVYFTSGTQEGSPIDRLIGAMAQSMNLDRQHLARQSGTGRSYFIEKLFTAV
AFAERGLVGVNPKVERRRKWIARGVLAATVALVVVVSGLWWVSYRANQAYIAQVDQKVAPLGQTVQNLSP
AQRDVLAVLPLLNAVKNLAGDSPSWSEGLGLYQGDMLEAESASVYRKLLIAVFAPRLVTRIEEQLHGGGN
SDFLYEGLKAYLMLADTEHYDPDFIKAWIALDWDRNLPRDLPADQRQALAGHLQALFERHPPSARLDPRL
IDDLRRQLQQLPVAQRVYDRVKRQKLPEGIPDFRINEAAGRDAALVFSRKSGKPLGEPLSGFFTAKGYRQ
AFLLSSLNQTGTLAEEQWVLGHEQADQQNVVSLAADVRRLYFQDYQRQWDALLADIDFVPITSVAQAADV
LRVISGPTSPLKKLLVAVAKETDLQAEERQLAAKGVPVEGGVDKLKERLGSLLGQEQPTANTPVAADDPV
TAHFAELNSIVSKNEGEPAAIDGLLTDMNALYVQVSAMVGASGDALLGEAKNQAAAAATRVSLNAERQPP
LVQGMVKSVVNSTTNSMMGGVRNQLNAAWVSEVVNVYRQSLAGRYPMSPGSARDATLDDFGQFFGVGGVM
DNYFRKYLQPYVDTSAQTWRWQPGAAQKLGIAPGVLQTFQRAATIRDAFFRAGGTQPIVRFELKPVSMDP
TITQFLLDLDGQQLSYDHGPSRPVAMQWPNPGSIGVVRISIMPPSASGRSGVTLDGPWAWFRLLEQSDLT
AGNSPDRFNLRLRVDGASIAYELRANSAFNPFKSRVLSGFSLPERL
 
Nucleotide Sequence: 3501 bp     [Download]
>ref|NC_012660.1|:c6573996-6570496 hypothetical protein PFLU6013 [Pseudomonas fluorescens SBW25]
GTGAAGGCGTTTTTCAGTTTCATGATTCGCTGGGTGATCCCCGTGCTGGGCCTGATCGCCCTGAGCCTGA
TCATCTGGTTTGTCGGGCCGTTGCTCGATGTGCTGGTGCCGGAAGGGCGCCGTTGGGCGCTGATCATTCT
GGTGTTTGCGGTATGGATTGCCTACCGCGTGTTCCGCATCATCCAGGCCCGCCGCCAGGCCGCCGAAGTG
ATGCGCAGCCTGGCCGCGCAAACCCCGGCCGACCCCAACAGCACCGCTACCGCCGAAGAACTCACCACCC
TGCGCCAGCGCATGGACGAGGCCCTGGCGCTGCTGAAAAAGGCCAAGCTGGGTGGCGATGAACGCCGCAA
CCTCTACGAGCTGCCGTGGTACGTGATCATCGGCCCGCCGGGTTCGGGCAAGACCACGGCGCTGGTCAAC
TCCGGGCTGCATTTTCCGCTGGCTGCGCAGCTGGGCGCCGGTGCCGTGCGCGGCGTCGGCGGTACGCGCA
ACTGCGACTGGTGGTTCACCGATCAAGCCGTGTTGCTCGACACCGCCGGCCGCTACACCACTCAGGACAG
CAACTCCACGGTGGATAAAGCCGCGTGGCTGGGCTTCCTCGACCTGCTGAAAAAGCAGCGCTCGCGCCGC
CCGATCGATGGCGCCTTTATCGCCATCAGCCTGTCGGACCTGTTGCTGGGCACCGACCCCGAACGCGCCG
CCCATGCCGCCGCCATCCGCTTGCGTATTCAGGAGCTGTACACCCAACTGGGCGTGCGCTTCCCGATCTA
CCTGATGCTGACCAAGCTCGACCTGGTGCCGGGCTTCATGGAGTTCTTCGACAACCTCAGCAAGGAAGAG
CGCGCCCAGGTGTGGGGCATGACCTTTGCCCTGGACGACGGCAAAAACACCGACAGCCCGCTGGCGCATC
TGCAAAGCGAGTTCGCCGGCTTGGAGCAGCGCCTCAACGAACGCCTGGTGGAGCGCCTGCAACAGGAACG
CGACCCCGCGCGGCGCGACCTGATCTACGGCTTCCCGCAGCAGTTCGGTGCGTTGAAGGATTGCCTGCAA
AGCTTCCTCGAAGGCGTGTTCAAACCCAATGCCTTTGAAGAGCGCGTGTTGCTGCGCGGCGTGTACTTTA
CCAGCGGTACCCAGGAAGGCAGCCCGATTGACCGTCTGATCGGTGCGATGGCCCAGAGCATGAACCTGGA
CCGCCAGCACCTGGCGCGACAGAGTGGCACCGGGCGCAGTTATTTCATCGAAAAACTCTTCACTGCGGTA
GCGTTTGCCGAGCGTGGCCTGGTCGGGGTGAACCCGAAGGTCGAGCGTCGGCGCAAATGGATTGCGCGCG
GTGTGCTGGCCGCCACCGTGGCGCTGGTCGTGGTGGTCAGCGGCCTGTGGTGGGTGAGTTACCGCGCCAA
CCAGGCGTATATCGCCCAGGTCGACCAAAAGGTCGCGCCACTGGGCCAGACCGTGCAGAACCTGAGCCCG
GCGCAGCGCGACGTCCTCGCCGTGCTGCCGTTGCTCAACGCCGTTAAGAACCTGGCGGGCGACTCGCCCA
GCTGGTCCGAAGGCCTCGGGCTGTACCAGGGCGACATGCTTGAAGCCGAGTCCGCCAGTGTTTACCGCAA
GCTGTTGATCGCGGTGTTCGCGCCACGCCTGGTGACGCGCATCGAAGAACAACTGCACGGTGGTGGCAAT
TCCGACTTCCTCTACGAAGGCCTCAAGGCTTACCTGATGCTCGCTGACACCGAGCATTACGACCCGGACT
TTATCAAGGCCTGGATCGCCCTCGACTGGGACCGCAACCTGCCCCGCGATCTGCCGGCGGACCAACGGCA
GGCCCTGGCCGGGCATTTGCAGGCGCTGTTCGAACGTCATCCGCCGAGCGCACGCCTCGACCCACGTTTG
ATTGATGACCTGCGTCGCCAGTTGCAACAACTGCCGGTGGCCCAGCGCGTCTACGACCGGGTCAAGCGCC
AGAAACTGCCCGAGGGCATCCCGGACTTTCGCATCAACGAAGCCGCCGGTCGTGACGCAGCGCTGGTGTT
CAGCCGCAAAAGCGGCAAGCCGCTGGGCGAGCCGTTGAGTGGTTTCTTCACCGCCAAAGGCTATCGCCAG
GCGTTCCTGCTGAGCAGCCTGAACCAGACCGGCACCCTCGCCGAAGAGCAGTGGGTGTTGGGCCACGAAC
AGGCCGACCAACAGAACGTGGTGAGCCTGGCCGCCGACGTGCGCCGCCTGTATTTCCAGGATTACCAGCG
CCAGTGGGATGCCTTGCTCGCGGACATCGACTTCGTGCCGATCACCAGCGTGGCCCAGGCGGCCGACGTG
CTGCGGGTGATTTCCGGCCCGACCTCGCCGCTGAAAAAACTGCTGGTGGCCGTGGCCAAGGAAACCGATC
TGCAAGCCGAAGAACGCCAGCTGGCCGCCAAAGGTGTGCCGGTGGAAGGGGGCGTCGACAAACTCAAGGA
GCGCCTGGGCAGCCTGCTCGGCCAGGAGCAACCGACCGCCAATACGCCCGTCGCTGCGGATGATCCGGTG
ACCGCGCACTTCGCCGAACTCAACAGCATCGTCAGCAAGAACGAAGGCGAGCCGGCGGCCATCGATGGCC
TGCTCACCGACATGAATGCGCTGTATGTGCAGGTCAGCGCCATGGTAGGCGCCAGCGGCGATGCGTTGCT
CGGCGAAGCAAAGAACCAGGCGGCGGCTGCGGCCACACGGGTCAGCCTGAATGCCGAGCGCCAGCCGCCG
TTGGTGCAGGGCATGGTCAAGTCGGTGGTCAACTCCACCACCAACAGCATGATGGGCGGCGTGCGTAACC
AGTTGAACGCGGCCTGGGTCAGTGAAGTGGTCAACGTGTATCGCCAGTCGCTGGCCGGGCGTTACCCGAT
GTCGCCGGGCAGTGCGCGGGATGCCACCCTGGATGACTTCGGCCAGTTCTTTGGGGTGGGCGGGGTGATG
GACAACTACTTCCGCAAATACCTGCAGCCCTACGTGGACACCTCCGCGCAGACCTGGCGCTGGCAACCGG
GCGCCGCACAGAAACTCGGGATTGCACCGGGTGTGCTGCAAACCTTCCAGCGTGCGGCGACGATCCGCGA
TGCGTTCTTCCGCGCCGGGGGGACCCAGCCGATTGTGCGGTTCGAACTCAAGCCGGTGTCGATGGACCCG
ACTATCACGCAGTTTTTGCTTGACCTCGACGGCCAGCAATTGAGCTACGACCACGGCCCCAGCCGCCCGG
TGGCGATGCAATGGCCGAACCCTGGCAGTATTGGCGTGGTGCGCATTTCGATCATGCCGCCATCGGCCAG
TGGCCGTTCGGGCGTGACTCTGGACGGGCCGTGGGCCTGGTTCCGCTTGCTCGAGCAATCGGACCTCACC
GCCGGTAATTCGCCGGACCGTTTCAACCTGCGCCTGCGCGTCGACGGTGCGAGCATCGCCTACGAGCTGC
GCGCCAACAGTGCCTTCAACCCGTTCAAGAGCCGCGTGCTCAGCGGCTTCAGCCTGCCGGAGCGGCTATG
A
 Primer design