SecReT6
Protein ID: 229593379
SecReT6 ID482
T6SS typei3
Gene symbol-
Locus tagPFLU6014
StrainPseudomonas fluorescens SBW25
Repliconchromosome [GenBank: NC_012660] [Browse all T6SS(s) in this replicon]
Location [Strand]6573993..6575282 [-]
Producthypothetical protein
NoteTssL
UniProt IDC3K4A2
KEGG IDpfs:PFLU6014
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 5.60E-70, Aligned region: 46..251
OmpA [PF00691], Evalue: 3.40E-15, Aligned region: 319..417
DUF883 [PF05957], Evalue: 0.00018, Aligned region: 70..120
DUF883 [PF05957], Evalue: 0.00018, Aligned region: 181..248
DUF883 [PF05957], Evalue: 0.00018, Aligned region: 316..353
Protein Sequence: 429 a.a.     [Download]
>gi|229593379|ref|YP_002875498.1| hypothetical protein PFLU6014 [Pseudomonas fluorescens SBW25]
MHPNDDDRTQFMPRPGGRAPEPVRAEPSPLAMPAAPMLTGKSQGLNPLESAAGPLLALLTRLRNTIAHPA
PASLRAQLLAYLRQFEERAEAAGIARNEVLLARYALCTALDEAVLSTPWGSTSDWGKQSLLITVHNEAWG
GEKVFQLLDHCLQSPRERLYLLELLYLCMCLGFEGRYRVMNDGRSHLEALRERTAAAIRSARGEHERELS
PHWRGVTVARDRLAQFMPPWIAVAIGVALLLALLFGLRLKLASDAEPVFKNIHALGEIPVQAIDRPVAQP
KVIERPRLAGFLVEDIKAGRVAVEDAVDRSVVTIRGDELFASASSSIVDDYQPLMLRIADAIRKVKGQVR
VTGHSDNRPIATLRFPSNWALSEARAKSVLDILAAKTGQADRFSAEGRSDTEPVATNATAEGRARNRRVE
ITVLAEGVE
 
Nucleotide Sequence: 1290 bp     [Download]
>ref|NC_012660.1|:c6575282-6573993 hypothetical protein PFLU6014 [Pseudomonas fluorescens SBW25]
ATGCATCCCAATGATGATGACCGCACTCAGTTCATGCCGCGTCCGGGTGGCCGGGCGCCGGAACCGGTGC
GTGCCGAACCTTCGCCGCTGGCCATGCCGGCCGCGCCGATGCTCACCGGCAAGAGCCAGGGCCTCAACCC
GCTGGAAAGCGCCGCCGGCCCCTTGCTGGCGCTGCTGACGCGCCTGCGCAACACCATCGCCCACCCGGCA
CCGGCCAGTCTGCGCGCACAGTTGTTGGCTTACTTGCGCCAGTTCGAAGAGCGCGCCGAAGCGGCCGGTA
TCGCCCGCAACGAAGTGCTGCTGGCCCGTTACGCGCTGTGCACCGCGCTGGATGAAGCGGTATTGAGCAC
GCCTTGGGGCAGCACCAGTGATTGGGGCAAGCAGAGCCTGCTGATCACCGTGCACAACGAAGCCTGGGGT
GGCGAAAAAGTCTTCCAGTTGCTCGACCACTGCCTGCAAAGCCCGCGGGAACGCCTGTACCTGCTGGAGT
TGTTGTACCTGTGCATGTGCCTGGGTTTCGAAGGCCGCTACCGCGTGATGAACGACGGTCGCAGCCACTT
GGAAGCCCTGCGCGAGCGCACCGCCGCGGCCATTCGCAGTGCGCGTGGTGAACACGAGCGTGAGCTGTCG
CCGCACTGGCGCGGCGTGACCGTGGCCCGTGATCGCCTGGCGCAATTCATGCCGCCGTGGATCGCCGTGG
CCATCGGCGTCGCGCTCCTGCTGGCGTTGCTGTTTGGTTTGCGTTTGAAGCTGGCGTCGGATGCTGAGCC
GGTGTTCAAGAATATCCATGCCCTGGGTGAGATCCCGGTGCAGGCCATCGACCGTCCGGTGGCGCAGCCT
AAAGTCATCGAGCGCCCACGTCTGGCCGGCTTCCTGGTGGAAGACATAAAGGCGGGGCGCGTTGCCGTGG
AAGATGCGGTCGACCGTTCGGTGGTCACCATCCGTGGCGATGAGCTGTTTGCGTCCGCCAGCTCCAGCAT
CGTCGATGACTACCAGCCGCTGATGCTGCGCATCGCCGACGCCATCCGCAAGGTCAAGGGCCAGGTGCGG
GTGACCGGGCACAGTGACAACCGCCCGATTGCCACGCTGCGTTTCCCGTCCAACTGGGCGCTGTCCGAAG
CGCGGGCCAAGTCGGTGCTGGACATCCTCGCGGCCAAGACCGGCCAGGCAGACCGCTTCAGCGCCGAGGG
CCGCAGCGACACCGAGCCGGTGGCGACCAACGCCACCGCCGAAGGCCGTGCCCGCAATCGTCGGGTTGAA
ATCACCGTATTGGCGGAGGGCGTCGAGTGA
 Primer design