SecReT6
Protein ID: 229593380
SecReT6 ID482
T6SS typei3
Gene symbol-
Locus tagPFLU6015
StrainPseudomonas fluorescens SBW25
Repliconchromosome [GenBank: NC_012660] [Browse all T6SS(s) in this replicon]
Location [Strand]6575289..6576623 [-]
Producthypothetical protein
NoteTssK
UniProt IDC3K4A3
KEGG IDpfs:PFLU6015
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.60E-156, Aligned region: 19..443
Protein Sequence: 444 a.a.     [Download]
>gi|229593380|ref|YP_002875499.1| hypothetical protein PFLU6015 [Pseudomonas fluorescens SBW25]
MSWNNRVVWSEGMFIGTQHFQQHDRYLENLIDARSRPLSAGAWGFSELLIDQGLLAQGKLAIVSARGLLP
DGTPFNIPQDDLAPSPLNIDDNLRDGLVYLALPLKRAGARDTVDEGEALEAARYVSQVREVRDDNAPFEN
RAPVAVGSRALRLLTAQDGISDYAAVGLVRIKEKRADRALVLDDTYIPPVLDVAASKPLTAFRSELLGLL
HQRGEALAGRVVASGAGGASEIADFMLLQLVNRAQPLIQHLSQLSPLHPERFFSELVSLAGEFSTFSTSG
RRPQEYPQYQHDDLALSFAPVMAALREALSMLIDSKATPIPIVEKAYGVHVAMLADKTLLDNASFILVVR
ADVPGETLRARFGQQSKVGSVEHIRDLVNLQLPGISLLPLPVAPRQLPYHAGSTYYELDRGSEAWQQLGN
SGGFAFHIAGQFPGLNLAFWAIRG
 
Nucleotide Sequence: 1335 bp     [Download]
>ref|NC_012660.1|:c6576623-6575289 hypothetical protein PFLU6015 [Pseudomonas fluorescens SBW25]
ATGTCCTGGAACAATCGCGTGGTCTGGTCGGAAGGCATGTTCATCGGAACGCAGCACTTCCAGCAGCATG
ACCGTTACCTGGAAAACCTGATCGACGCCCGCAGCCGCCCGTTGTCCGCCGGCGCCTGGGGGTTTTCCGA
GCTGCTGATCGACCAGGGCCTGCTGGCCCAGGGCAAGCTGGCGATCGTATCGGCGCGCGGCCTGCTGCCG
GACGGTACGCCGTTCAACATCCCCCAGGACGACCTGGCACCGAGCCCGTTGAATATTGACGACAACCTGC
GCGACGGCCTGGTGTACCTGGCGCTGCCGCTCAAGCGTGCCGGCGCCCGCGATACCGTGGATGAAGGCGA
AGCCCTGGAAGCGGCGCGTTACGTGAGCCAGGTCCGCGAAGTGCGCGACGACAACGCCCCGTTCGAAAAT
CGCGCCCCGGTGGCCGTGGGTTCCCGCGCCCTACGTCTGCTGACTGCCCAGGATGGCATCAGCGATTACG
CCGCCGTGGGCTTGGTGCGCATCAAGGAAAAGCGCGCCGACCGTGCGCTGGTGCTCGACGACACTTACAT
TCCGCCGGTGCTGGACGTCGCCGCGAGCAAGCCGCTGACGGCGTTTCGCAGTGAACTGCTCGGCCTGCTG
CACCAGCGCGGCGAGGCCTTGGCTGGCCGCGTAGTTGCCTCGGGCGCCGGTGGCGCGTCGGAGATTGCCG
ACTTCATGCTGCTGCAACTGGTCAACCGTGCCCAACCGCTGATCCAGCATTTGAGCCAGTTGAGCCCGCT
GCACCCGGAGCGTTTCTTCAGTGAGTTGGTCAGCCTGGCCGGCGAGTTCTCGACCTTCTCCACCTCGGGC
CGTCGCCCGCAGGAATACCCGCAGTACCAGCACGACGACTTGGCCCTGAGCTTTGCCCCGGTGATGGCGG
CGTTGCGTGAAGCGCTGTCGATGCTGATCGACAGCAAGGCCACGCCGATCCCGATTGTCGAGAAAGCCTA
CGGCGTGCACGTGGCGATGCTGGCCGACAAGACCCTGCTCGACAACGCCAGCTTCATCCTCGTGGTGCGG
GCCGACGTGCCCGGTGAAACCCTGCGTGCGCGCTTCGGCCAGCAGAGCAAAGTCGGCTCGGTGGAGCACA
TCCGCGACCTGGTCAACCTGCAACTGCCGGGCATCAGCCTGTTGCCTCTGCCGGTGGCGCCACGCCAACT
GCCGTACCACGCCGGCTCGACCTATTACGAGCTGGATCGCGGCAGCGAGGCCTGGCAACAGTTGGGCAAC
TCCGGCGGTTTTGCCTTCCATATCGCCGGGCAGTTCCCGGGCTTGAACCTGGCCTTCTGGGCGATCCGAG
GATAA
 Primer design