SecReT6
Protein ID: 229593381
SecReT6 ID482
T6SS typei3
Gene symbol-
Locus tagPFLU6016
StrainPseudomonas fluorescens SBW25
Repliconchromosome [GenBank: NC_012660] [Browse all T6SS(s) in this replicon]
Location [Strand]6576642..6577151 [-]
Productputative lipoprotein
NoteTssJ
UniProt IDC3K4A4
KEGG IDpfs:PFLU6016
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.40E-39, Aligned region: 12..154
Protein Sequence: 169 a.a.     [Download]
>gi|229593381|ref|YP_002875500.1| putative lipoprotein [Pseudomonas fluorescens SBW25]
MIPRFLLAIATLLLLTACAKDAAKPETAAEAEADTAAVELHFHAISGLNPGANGQAAPVRVRIFELKNAA
TFARSDYFALADRAQSTLGLDLLDQDEVMVQPGEQLSIQRDLDPSTRQIGLLVGYRELDRAQWRTVINVP
ARQYTEYQISLDVRAVRADVVVTPSSPAQ
 
Nucleotide Sequence: 510 bp     [Download]
>ref|NC_012660.1|:c6577151-6576642 putative lipoprotein [Pseudomonas fluorescens SBW25]
ATGATTCCCAGGTTTTTACTCGCAATTGCCACACTGCTTTTGCTGACGGCGTGTGCCAAAGACGCCGCCA
AACCCGAAACCGCCGCCGAGGCTGAAGCGGATACGGCCGCCGTCGAGCTGCACTTCCACGCGATCAGCGG
GCTTAACCCCGGCGCCAACGGCCAGGCCGCGCCGGTGCGGGTGCGCATCTTCGAACTGAAAAACGCCGCC
ACCTTCGCCCGTTCCGATTACTTCGCCCTGGCTGACCGGGCGCAATCGACCCTGGGCCTGGACCTGCTGG
ACCAGGACGAAGTGATGGTGCAACCCGGCGAGCAACTGAGCATCCAGCGCGACCTCGACCCGTCCACGCG
CCAGATCGGGCTCTTGGTGGGCTATCGCGAGTTGGACCGTGCGCAATGGCGCACGGTGATCAACGTGCCC
GCGCGCCAATACACCGAATACCAGATCAGCCTCGATGTACGCGCCGTGCGCGCCGACGTCGTGGTCACCC
CATCCAGCCCTGCCCAATAA
 Primer design